KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0991Help
Entry
Teth39_0991       CDS       T00649                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00010  Glycolysis / Gluconeogenesis
tpd00052  Galactose metabolism
tpd00500  Starch and sucrose metabolism
tpd00520  Amino sugar and nucleotide sugar metabolism
tpd00521  Streptomycin biosynthesis
tpd01100  Metabolic pathways
tpd01110  Biosynthesis of secondary metabolites
tpd01120  Microbial metabolism in diverse environments
tpd01130  Biosynthesis of antibiotics
tpd01200  Carbon metabolism
Module
tpd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth39_0991
   00052 Galactose metabolism
    Teth39_0991
   00500 Starch and sucrose metabolism
    Teth39_0991
   00520 Amino sugar and nucleotide sugar metabolism
    Teth39_0991
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Teth39_0991
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Teth39_0991
Enzymes [BR:tpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Teth39_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK HTH_24 MarR MarR_2 Fe_dep_repress HTH_27 SMC_ScpB FeoC Phage_rep_O RPA_C HTH_IclR HTH_Crp_2 TBPIP
Motif
Other DBs
NCBI-ProteinID: ABY94646
JGI: Teth390991
UniProt: B0K933
Position
1054521..1055666
Genome map
AA seq 381 aa AA seqDB search
MKDYTKGTSGLIKNINKANVLDVIKKMQPISRIEVSKVLKMSKSTISAIVDELIEEGLVI
ENGYGEKGTVGRKPIQLSFNPDARFVIGISVESTNSIGILTNLEGKILKKIKWETGIKEQ
AFNGIVKGIKELAEEDKNIIGIGIGLPGITDIQKGIVDAPGLKWSNFDLKKRLSEIFNYN
IYVDNSVNYAALGERWIGCCREIENFVLINIGNGIGSGIYVNGTLLRGNSYAAGEVGYMA
IGEDAFERVYSYEDYGYFERKASLSALVESVSKSLPYVKTMEGVVKEYKKQNPACVQAVS
QFIKNLSMGIANIVSILNPEVIIIGGDILNYEIDIRQELKEKVKRIVPFDFDIKVAQLGE
DASAIGAVADVLLNTNNLILL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagactatactaaaggcacttcagggttaattaaaaatatcaataaagccaatgtt
ttagatgttattaaaaagatgcaacccatatcgagaatagaggtttctaaagttttaaaa
atgagcaaatctactatttctgccattgtagatgagttgattgaagaaggtttggtaata
gaaaatggttacggagaaaaaggtacagtagggagaaagcctatacagctttcttttaat
cctgatgctagatttgttatagggataagcgttgaatctacaaattcgataggaattctg
actaatttagaggggaaaattttaaaaaagataaaatgggaaactggcattaaagaacag
gcttttaatggaattgtgaaagggataaaagaacttgctgaggaagataaaaatataata
ggaattggtattggtcttccaggaatcacagatatacaaaaaggaattgttgatgcacca
ggattgaaatggagtaattttgatttaaagaaaaggttgagtgaaatttttaattataac
atctacgtggacaacagtgtaaattatgctgcactgggcgagagatggattggttgttgc
cgtgaaatagagaattttgtgcttataaacataggaaatggtataggctcgggaatatat
gtaaatggtactttattacgaggcaatagttacgctgcaggggaagtagggtacatggcc
ataggagaggatgcttttgaaagagtttattcttacgaggattatggttattttgaaaga
aaggcttctttgtctgctttagttgaatcagtttctaaaagtttgccttatgtaaaaact
atggagggtgtagtaaaagaatataaaaaacaaaatcctgcttgtgtacaagctgtatct
caatttattaaaaatttaagcatgggtattgccaatattgtaagtatcttaaacccagaa
gtgataataattggaggagacattttaaactatgaaattgatatacgccaggagctaaag
gagaaagtgaaaaggattgtgccttttgattttgacattaaagtagctcaacttggtgaa
gatgcttctgctattggggcggtagccgatgtgcttttaaatacaaataatttaatttta
ctataa

DBGET integrated database retrieval system