KEGG   Thermoanaerobacter pseudethanolicus: Teth39_0991Help
Entry
Teth39_0991       CDS       T00649                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Teth39_0991
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth39_0991
   00052 Galactose metabolism
    Teth39_0991
   00500 Starch and sucrose metabolism
    Teth39_0991
   00520 Amino sugar and nucleotide sugar metabolism
    Teth39_0991
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Teth39_0991
   00524 Butirosin and neomycin biosynthesis
    Teth39_0991
Enzymes [BR:tpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Teth39_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1054521..1055666
Genome map
AA seq 381 aa AA seqDB search
MKDYTKGTSGLIKNINKANVLDVIKKMQPISRIEVSKVLKMSKSTISAIVDELIEEGLVI
ENGYGEKGTVGRKPIQLSFNPDARFVIGISVESTNSIGILTNLEGKILKKIKWETGIKEQ
AFNGIVKGIKELAEEDKNIIGIGIGLPGITDIQKGIVDAPGLKWSNFDLKKRLSEIFNYN
IYVDNSVNYAALGERWIGCCREIENFVLINIGNGIGSGIYVNGTLLRGNSYAAGEVGYMA
IGEDAFERVYSYEDYGYFERKASLSALVESVSKSLPYVKTMEGVVKEYKKQNPACVQAVS
QFIKNLSMGIANIVSILNPEVIIIGGDILNYEIDIRQELKEKVKRIVPFDFDIKVAQLGE
DASAIGAVADVLLNTNNLILL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagactatactaaaggcacttcagggttaattaaaaatatcaataaagccaatgtt
ttagatgttattaaaaagatgcaacccatatcgagaatagaggtttctaaagttttaaaa
atgagcaaatctactatttctgccattgtagatgagttgattgaagaaggtttggtaata
gaaaatggttacggagaaaaaggtacagtagggagaaagcctatacagctttcttttaat
cctgatgctagatttgttatagggataagcgttgaatctacaaattcgataggaattctg
actaatttagaggggaaaattttaaaaaagataaaatgggaaactggcattaaagaacag
gcttttaatggaattgtgaaagggataaaagaacttgctgaggaagataaaaatataata
ggaattggtattggtcttccaggaatcacagatatacaaaaaggaattgttgatgcacca
ggattgaaatggagtaattttgatttaaagaaaaggttgagtgaaatttttaattataac
atctacgtggacaacagtgtaaattatgctgcactgggcgagagatggattggttgttgc
cgtgaaatagagaattttgtgcttataaacataggaaatggtataggctcgggaatatat
gtaaatggtactttattacgaggcaatagttacgctgcaggggaagtagggtacatggcc
ataggagaggatgcttttgaaagagtttattcttacgaggattatggttattttgaaaga
aaggcttctttgtctgctttagttgaatcagtttctaaaagtttgccttatgtaaaaact
atggagggtgtagtaaaagaatataaaaaacaaaatcctgcttgtgtacaagctgtatct
caatttattaaaaatttaagcatgggtattgccaatattgtaagtatcttaaacccagaa
gtgataataattggaggagacattttaaactatgaaattgatatacgccaggagctaaag
gagaaagtgaaaaggattgtgccttttgattttgacattaaagtagctcaacttggtgaa
gatgcttctgctattggggcggtagccgatgtgcttttaaatacaaataatttaatttta
ctataa

DBGET integrated database retrieval system