KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1013Help
Entry
Teth39_1013       CDS       T00649                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Teth39_1013 (ruvA)
Enzymes [BR:tpd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Teth39_1013 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1077210..1077773
Genome map
AA seq 187 aa AA seqDB search
MIEYVRGIIEDIGQDYVVIDFMGIGIKVFVPFSTLKVLPSKGNITKLYTYLQVREDGFQI
FGFKTKEELDLFEKLLSVSGVGPKGALSILSVVSIDNFVKAVNAGDYKALTVAPGIGKKT
AERIILELKDKLPKEIVFEGDNNFSNEALEALLALGYTKSEAIYALADITCDSVEDAVKQ
ALKKLMK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtatgttagagggataattgaagatattggacaagattacgtagtgattgac
tttatgggtataggtataaaggtttttgttcccttttctactttaaaagttttaccttct
aaaggaaatataaccaagctttatacatatttacaggtgagagaagatggttttcaaatt
tttggctttaaaacaaaagaagagctagatttgtttgaaaaattattgtctgttagtggt
gtagggccgaaaggagctttgtctattttgtccgtggtttctattgacaattttgtaaaa
gcagttaacgcaggcgattataaagctcttacagtagctccgggaataggcaaaaagact
gctgagagaattattttggaattaaaagataagcttccaaaagaaatagtttttgaaggt
gataataatttttcaaatgaggctttagaagctttattagcgttgggttacaccaagagt
gaagctatttatgctttggcagatatcacctgtgatagcgtagaagatgctgtaaagcaa
gctttgaaaaaattaatgaaatag

DBGET integrated database retrieval system