KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1144Help
Entry
Teth39_1144       CDS       T00649                                 

Definition
(GenBank) putative agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00330  Arginine and proline metabolism
tpd01100  Metabolic pathways
Module
tpd_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Teth39_1144
Enzymes [BR:tpd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Teth39_1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ABY94799
JGI: Teth391144
UniProt: B0K9I6
Position
1194070..1194936
Genome map
AA seq 288 aa AA seqDB search
MIEGKYFVDPGKFLGATEDYEKAEVVILGLPMDYTVSFKAGSRFGPAAIRQASYGLEYYS
VYLDRRLEDKKFYDLGDLVLPYGNVKKSLDLISKATEDILKSGKKGLFLGGEHLVTYGIL
KEYLKKYGDNLVILHFDAHTDLREEFFGEAYSHATVMKKVWDIAKGIKMYNFGIRSGEKE
EFEFAEKNTHMFLYEVVEPLKGVIDDIKDYPIYISWDIDVVDPAFAPGTGTPEPGGITTK
EALEAIHILKDLNVVGMDLVEVSPSHDIAGITSILAAKLIRESILSFF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaggaaaatattttgttgatccgggaaagtttttaggggctactgaagattat
gaaaaggcagaggtagttatactaggtttgcctatggattacacagtgagtttcaaagca
ggaagccgctttggacctgctgccataaggcaagcctcttatggtttagaatattatagt
gtgtatttagataggaggttggaagataagaaattttatgatttaggagatttagtactt
ccttatgggaatgtgaaaaagagtctagatttaatctcaaaagctacagaagacattttg
aaaagtggaaaaaaaggattgttcttgggtggagaacatttagtgacttatggaatttta
aaagagtacttaaaaaaatatggggataaccttgtaatccttcattttgatgcccatact
gatttaagagaagaatttttcggtgaagcttattctcacgccacagtaatgaaaaaagta
tgggatattgctaaaggtattaaaatgtataattttgggataaggtcaggtgaaaaagaa
gaatttgagtttgcagaaaaaaatacccacatgtttttgtatgaagtagttgaacctttg
aaaggtgtaattgatgatataaaagattatccaatttatattagctgggatatagatgtt
gtagaccctgcttttgcaccaggcactggtacaccagaaccagggggaataaccacaaaa
gaggcattagaggcaattcatattttaaaagatttaaatgtagttgggatggatttggtg
gaagtctcgccttctcacgatatagctggtataacctctattttagcagctaaacttata
agggaatctatcctttccttcttctaa

DBGET integrated database retrieval system