KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1233Help
Entry
Teth39_1233       CDS       T00649                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Teth39_1233
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Teth39_1233
Enzymes [BR:tpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Teth39_1233
Two-component system [BR:tpd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Teth39_1233
Bacterial motility proteins [BR:tpd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Teth39_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1279939..1280523)
Genome map
AA seq 194 aa AA seqDB search
MKNDCLVIIGASTGGPKALQYILTNLPKDLFASVIVVQHMPEKFTRMMAERLDQSCKIKV
KEAVDGEVILKNVAYIAPGDKNLLLIEENDKIKIKLSTNFESVYKPSIDATFISASQINA
CIIAVILTGMGSDGSKGLKYLKEKGSFIICQDIESSLAKGMPYNAIKTGFVDKILPLDKI
PAEIIEKVRGFYGK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgattgtcttgttataataggggcttctactggggggcctaaagcactgcaa
tatatattaacaaatttaccaaaggacctttttgcttcagtaattgtagtacaacatatg
ccagaaaaatttactagaatgatggcagaaagattagaccaaagttgcaagatcaaagta
aaagaagcagtagatggagaggtaattttgaaaaatgtagcttatattgcacctggcgat
aaaaatttattattaattgaagaaaatgataaaataaaaattaaactttctacgaatttt
gaatctgtttataaaccttctattgatgctacttttataagtgcttcccaaataaatgcc
tgcataatagctgttattttgacaggtatgggaagtgatggttcaaaaggacttaaatat
ttaaaagagaaaggaagttttattatatgtcaggatatcgaatcttctctggcaaaagga
atgccttataacgctataaaaacaggatttgttgataaaatccttcctttggataaaatt
ccagcagaaataattgagaaggtgaggggattttatggaaaataa

DBGET integrated database retrieval system