KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1233Help
Entry
Teth39_1233       CDS       T00649                                 

Definition
(GenBank) CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd02020  Two-component system
tpd02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Teth39_1233
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Teth39_1233
Enzymes [BR:tpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Teth39_1233
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Teth39_1233
Two-component system [BR:tpd02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Teth39_1233
Bacterial motility proteins [BR:tpd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Teth39_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: ABY94887
JGI: Teth391233
UniProt: B0K9S4
Position
complement(1279939..1280523)
Genome map
AA seq 194 aa AA seqDB search
MKNDCLVIIGASTGGPKALQYILTNLPKDLFASVIVVQHMPEKFTRMMAERLDQSCKIKV
KEAVDGEVILKNVAYIAPGDKNLLLIEENDKIKIKLSTNFESVYKPSIDATFISASQINA
CIIAVILTGMGSDGSKGLKYLKEKGSFIICQDIESSLAKGMPYNAIKTGFVDKILPLDKI
PAEIIEKVRGFYGK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgattgtcttgttataataggggcttctactggggggcctaaagcactgcaa
tatatattaacaaatttaccaaaggacctttttgcttcagtaattgtagtacaacatatg
ccagaaaaatttactagaatgatggcagaaagattagaccaaagttgcaagatcaaagta
aaagaagcagtagatggagaggtaattttgaaaaatgtagcttatattgcacctggcgat
aaaaatttattattaattgaagaaaatgataaaataaaaattaaactttctacgaatttt
gaatctgtttataaaccttctattgatgctacttttataagtgcttcccaaataaatgcc
tgcataatagctgttattttgacaggtatgggaagtgatggttcaaaaggacttaaatat
ttaaaagagaaaggaagttttattatatgtcaggatatcgaatcttctctggcaaaagga
atgccttataacgctataaaaacaggatttgttgataaaatccttcctttggataaaatt
ccagcagaaataattgagaaggtgaggggattttatggaaaataa

DBGET integrated database retrieval system