KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1556Help
Entry
Teth39_1556       CDS       T00649                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00040  Pentose and glucuronate interconversions
tpd00052  Galactose metabolism
tpd00500  Starch and sucrose metabolism
tpd00520  Amino sugar and nucleotide sugar metabolism
tpd01100  Metabolic pathways
tpd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Teth39_1556
   00052 Galactose metabolism
    Teth39_1556
   00500 Starch and sucrose metabolism
    Teth39_1556
   00520 Amino sugar and nucleotide sugar metabolism
    Teth39_1556
Enzymes [BR:tpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Teth39_1556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABY95201
JGI: Teth391556
UniProt: B0KAR7
Position
complement(1587848..1588756)
Genome map
AA seq 302 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKNKESLLNLVEDISNMVNIHYIRQKEPKGLGHAIYCAKSFV
GNEPFAVLLGDDIVDSEVPVLKQMIDQYERYNCSIIGVQEVPYEDVDKYGIVDAAIIEDR
LYKVKDLVEKPKKEKAPSNIAILGRYIITPRIFEILENTPPGAGGEIQLTDALKTLLNYE
AIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLSEPFKRYLLELVDNLTAIEKEAAVTK
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataagaaaggcgataattccggctgcaggccttggtacgaggtttttgcctgct
accaaggctcagcctaaagaaatgcttccaattgtggacaaacccactattcaatatata
gtcgaagaggcgattcaatcgggaattgaggatatccttataataactggcagaaataaa
agagcaatagaagaccattttgataaatctgtggagttggagctggagttaaaaaagaaa
aacaaggaaagtttacttaaccttgtagaggatattagcaatatggtgaacattcactat
ataaggcaaaaggaacctaaagggttgggacatgctatttactgtgctaaatcttttgta
ggaaatgagccttttgcagtacttttaggagatgacatagtagattcagaagtgccggtt
ttaaagcagatgattgaccaatacgaaaggtacaactgttctattattggggtacaagag
gtgccgtatgaggatgtagataaatatggaatagttgacgctgctattattgaggataga
ttatacaaagtcaaagaccttgtggaaaagcctaaaaaagaaaaggcgccttctaacatc
gctattttgggaagatatataattacaccaagaatatttgaaatattggaaaacacgcca
ccaggagcaggaggtgaaatacagcttacagatgctttaaaaactctcttaaattatgaa
gcaatttacgcctataattttattggcaagagatatgatgtgggagataaattaggttac
cttatggcaactgttgagtatgctctaaaaagagaggacttaagtgaaccttttaagagg
tatttattagaacttgttgacaatttaacagctatcgaaaaggaggctgcggttacaaaa
gtaaaatag

DBGET integrated database retrieval system