KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1625Help
Entry
Teth39_1625       CDS       T00649                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00521  Streptomycin biosynthesis
tpd00523  Polyketide sugar unit biosynthesis
tpd01130  Biosynthesis of antibiotics
Module
tpd_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Teth39_1625
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Teth39_1625
Enzymes [BR:tpd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Teth39_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABY95267
JGI: Teth391625
UniProt: B0KB79
Position
complement(1658342..1658893)
Genome map
AA seq 183 aa AA seqDB search
MGKFKFIETEIEGLYIIETGIFEDNRGYFMESYNYNDFKVAGLDMVFVQDNQSKSKRGVL
RGLHFQKKHPQGKLVRVLKGEVFDVAVDLRKNSKTYGKWVGVILSEENKKQFYIPEGFAH
GFLVLSEEAEFFYKCTNFYYPDDEGGIIWNDPDINIQWPLDGIEEIILSEKDKKWPRLKD
LTF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatttaagtttatagaaacagaaatagaaggattatacataatagagacaggg
atttttgaagataacagaggatattttatggagtcgtataattacaatgactttaaagtt
gcaggtcttgatatggtgtttgttcaggataatcaatcaaaatcgaaaagaggagtatta
agaggattacactttcaaaaaaaacatccacaaggcaaactggtaagagttttaaaagga
gaagtttttgatgtagcagttgatttgagaaaaaactccaaaacttatggcaaatgggtt
ggtgttattttatccgaggaaaataaaaaacaattttatatccctgaaggattcgctcat
ggctttttagttttgtcagaggaagcagagtttttctacaaatgtacaaacttctattat
cctgatgatgaaggtgggataatatggaatgaccctgatataaatatacagtggccttta
gatggcattgaagaaataattttatctgaaaaggataaaaaatggccaaggctaaaggat
ttaacgttttaa

DBGET integrated database retrieval system