KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1850Help
Entry
Teth39_1850       CDS       T00649                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tpd  Thermoanaerobacter pseudethanolicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1903646..1904686)
Genome map
AA seq 346 aa AA seqDB search
MDYKDLLKKLSENHGVSGHERGIYDLLKKEFEPISDEVKEDNFGNLIFKKKGTKGKYKVM
LAAHLDEIGLMVKDIDEKGFIKFTPVGGVDQRTLPSQEVIVHGKKELLGVIGSKPPHLLS
SEDMKKAIKIDDMYVDVGLPKEEVEKLVSIGDIITVKREFKELLNENVSGKALDDRAGVV
VMAVCLEELKKVYHYHDVYAVVTLQEEVGVRGATTSSYNIEPDIAIAIDVTHAKARGVSR
DIEIGKGPAIGKGPNIHPAVYKGLVDIAKKYNINYQIEPLPGHSGTDAWAIQVSKKGVPT
GLVSIPLKYMHTSVETANMKDIIESGRLLAHYIANLPEELEGHLCY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggattataaggatttattaaaaaagcttagtgaaaatcacggggtttctggacatgag
agaggaatttatgacctcttaaaaaaagaatttgaaccaatttcagatgaagttaaagaa
gacaattttggcaatcttatttttaaaaagaagggcacaaaaggcaagtacaaggtgatg
ttagcagcccatctggatgaaatagggcttatggtgaaagatattgatgagaaaggattt
ataaagtttactcctgttggaggagtggaccaaaggactcttccttcacaggaagttata
gttcacggcaaaaaggaattattgggggttataggaagtaaaccgccacatcttttgtct
tcggaggatatgaaaaaggcgataaaaatagacgatatgtatgtagatgtcgggcttcca
aaagaagaggtagagaaacttgtaagtattggagatataataactgtaaagagggagttt
aaagagcttttgaatgagaatgtatcggggaaagctctggacgatagagcaggggttgtg
gtgatggcagtatgccttgaggagctcaagaaggtataccattatcacgacgtgtatgct
gtagttactcttcaggaagaggtgggggtaagaggagctacaacttcttcttacaatatt
gaacctgacatagctatagcgattgacgtgactcatgcgaaagcgaggggagttagccgc
gacatagagatagggaaagggcctgccatagggaagggacccaatattcatcctgctgta
tataaagggcttgtagatatagctaaaaaatacaatataaattatcagatagagccgctt
cctgggcattcaggcactgatgcatgggcaatccaggtgtcaaaaaaaggagttcctaca
gggcttgtgtcaatacctttgaagtacatgcatacttctgtggaaactgctaatatgaaa
gacataatagaaagtggcaggttgcttgctcactatattgccaatctgcctgaggaattg
gagggacatttatgctattaa

DBGET integrated database retrieval system