KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1874Help
Entry
Teth39_1874       CDS       T00649                                 

Definition
(GenBank) Cellulase
Organism
tpd  Thermoanaerobacter pseudethanolicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1926228..1927250)
Genome map
AA seq 340 aa AA seqDB search
MLLKELTEIMSASGDEKEIREKIKSIVEPYVDNVYVDKMGNLITCKKGKKDKPKIMLAAH
MDEVGLMVKSVNEDGTLSFSPVGGVDNRILVSKTVKVGEKKINGVIGAKPIHLQKREEQQ
RPLDYDSLYIDIGATSKEEALKHVSLGDYIYFDSNFEILGNDYVKAKALDDRIGCNVLIE
VLKNEYEYPICVAFTVQEEVGLRGAGVAAYNVEPDFAIVVEGTVAADVSDSVPHLVSTEL
GKGPAISLMDRTALYDKKVIDKIVKIAEENKVPYQFRRIASGGNDAGKIHLTKGGIKTIA
VSVPCRYIHSFNSVAFLEDFNNTVKLVDLIIKNIEKEALI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaagaattgacagaaataatgagtgcttcaggggatgaaaaggagataagg
gagaagataaaaagcattgttgaaccttatgtagataatgtttatgtagataaaatgggg
aatttgataacttgtaaaaaagggaaaaaagacaaacctaaaataatgttagctgctcat
atggacgaagtaggattgatggtaaaatcagtaaatgaagatggaacattgagcttttca
ccagttggcggagtagacaaccgcatacttgtttctaaaacagtaaaagtaggtgaaaag
aagataaacggcgttattggtgcaaagccaatacaccttcaaaaaagagaagagcagcaa
agaccacttgattatgattctctttacatagacataggagcgacttctaaggaagaagct
ttaaaacacgtttctctaggagactatatttattttgattcaaattttgaaatattggga
aacgactatgttaaagcgaaggctttggatgacaggataggatgcaatgttttgatagaa
gttttaaaaaatgagtatgaatatcctatttgtgtagctttcactgtgcaagaagaggtt
ggcttaaggggagctggtgttgcagcttataatgtagagcctgactttgctatagttgta
gaaggcactgttgcagcagatgtttccgattcagtaccccatttagtttctactgaactg
gggaaagggcctgcaatttcattaatggacaggaccgctctttacgataaaaaggtgatt
gacaagattgtaaaaatagcagaagagaataaagtgccttatcagtttaggaggatagcc
agtggtgggaatgacgcaggtaaaattcaccttacaaaaggtggcataaaaacaattgct
gtatcagtcccatgtaggtatattcattcttttaattctgtagcctttttagaagatttt
aataacacagttaaattggttgatttgataatcaaaaatattgaaaaggaggctttaata
tga

DBGET integrated database retrieval system