KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1889Help
Entry
Teth39_1889       CDS       T00649                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00860  Porphyrin and chlorophyll metabolism
tpd01100  Metabolic pathways
tpd01110  Biosynthesis of secondary metabolites
tpd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Teth39_1889
Enzymes [BR:tpd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Teth39_1889
Exosome [BR:tpd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Teth39_1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ABY95522
JGI: Teth391889
UniProt: B0KCR5
Position
complement(1940102..1941076)
Genome map
AA seq 324 aa AA seqDB search
MDLVKRPRRLRMNSILREMIRETSLDVGDLIYPLFVVPGDNIKEEIDSMPGVYHFSIDLL
VEEVKEVRDLGIPAILLFGVPSYKDELGSEAYSEEGIVQKAVREIKEKVPEIVVITDVCM
CGYTIHGHCGIVENGQVVNDKTIDYIAKIALSHVEAGADIVAPSDMMDGRVAAIRKLLDS
KGFVNTPIMAYSAKYASSFYGPFREAANSFPQFGDRKSYQMDYGNSNEALREIALDIEEG
ADIVMVKPALSYLDIIRRVKDNFNIPIAAYNVSGEYSMVKAAAKMGWIDEKSVVLEILTS
IKRAGADIVITYFAKDVAKWLITL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatttggtaaaaaggccaagaaggcttaggatgaacagtattttaagggagatgata
cgagaaacttctttagatgttggtgaccttatatatcctctttttgttgtgccaggagat
aatataaaagaagagatagattcaatgccgggtgtttaccatttttctatagatttgctt
gtagaagaagttaaagaagtgcgtgaccttggaattcctgctattttactttttggtgtg
ccttcatataaagatgaattagggtcagaggcttatagtgaggaaggcatcgttcaaaaa
gcggtgagagaaataaaagaaaaagtgcctgaaattgtggtaataacagatgtgtgtatg
tgtgggtatacaattcatggtcactgtggaattgttgaaaatggacaagttgtaaatgac
aaaacgatagattacatcgctaaaatagccttgtcccatgttgaggcaggggcggatatt
gtagcgccttctgacatgatggatggaagagtagctgccataagaaagcttttagatagt
aaaggatttgtaaacacacctattatggcttacagtgctaaatacgcttcctctttttat
ggaccttttagagaagcagcaaattctttcccacaatttggcgacagaaagtcttatcaa
atggactatggaaactccaacgaagccttaagagaaatagctcttgacattgaagaagga
gcagatattgtcatggtaaagccggcactttcttatcttgatattataaggcgggtaaag
gataatttcaacattcctattgctgcttataatgtaagtggagaatattcaatggtaaag
gcggcagctaagatgggttggattgatgaaaaatcggtagtcttagaaatactcacttca
attaaaagggcaggggcagacatagttataacctactttgcaaaggatgttgcaaaatgg
cttattaccctataa

DBGET integrated database retrieval system