KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1943Help
Entry
Teth39_1943       CDS       T00649                                 

Definition
(GenBank) Beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00010  Glycolysis / Gluconeogenesis
tpd00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth39_1943
   00500 Starch and sucrose metabolism
    Teth39_1943
Enzymes [BR:tpd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Teth39_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: ABY95574
JGI: Teth391943
UniProt: B0KCW7
Position
complement(1996390..1997784)
Genome map
AA seq 464 aa AA seqDB search
MAKEYKFPEGFWWGSATSAVQIEGAANEDGKGMNVWDYWYKNEPNRFFDRVGPQVTSDFY
HRYKDDIKLMKELGHNSFRFSISWSRLIPGGVGEVNKKAVEFYNSVIDELIKNDIEPFVT
LFHFDMPIEMQNMGGFENRKVVEYFAEYAKTCFELFGDRVKRWITFNEPIVPVLGGYLYN
FHYPDIVDFKRAVQFAYGTVLASARAIEEFKKLQIERAKIGIVLNLSPVYPRSNHPADLK
AAEIADLFYNRSFLDPTVKGEYPKELVELLKTYNHLPEYSDSDLELIKNNTVEYLGVNYY
QPIRVKAKENMPNPYGVFTPNWFYDEYIMPGRRMNPYRGWEIYERGIYDIMINLRDNYGN
IGSFISENGMGVEGEERFIKDGIIQDDYRIEFIKEHLKWLHKAIEEGCNVKGYHLWTFMD
NWSFLNAYKNRYGLVSVDLKTQKRTIKKSGYWYKELSENNGFVD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaatacaaatttcctgaaggattctggtgggggtctgcaacgtcagcagta
caaatagagggagctgcaaatgaagatggaaagggaatgaatgtatgggattattggtac
aaaaacgagccaaatcgctttttcgatagagtaggccctcaagtaacatctgatttttac
cacagatataaagacgatataaaactgatgaaagaacttggacataactcttttagattt
tctatttcatggtcgcggctgatacctggtggtgttggtgaagtcaataaaaaagccgta
gagttttataacagtgtcattgatgagcttataaaaaatgatatagaaccgtttgttacg
ctatttcactttgacatgcctatagaaatgcaaaacatgggaggttttgagaatagaaaa
gtagtagaatattttgctgaatatgccaaaacatgctttgagttgtttggagatagagtc
aaaagatggattacatttaatgaaccaatagttcctgtattaggtggatatttatataat
ttccattatccagatatagtagattttaaaagagcagtacaattcgcttatggcacagtg
ctggcaagtgcgagagcaatagaggaatttaaaaaattacaaatagaaagggctaaaata
ggtattgttttaaacttaagtcctgtatatcccaggagtaatcatccggctgatttaaaa
gccgcagagattgcagatttgttctataacagaagttttttggacccaactgtcaaagga
gagtatcctaaagaacttgttgaacttctaaaaacttacaatcatctaccagagtattcg
gatagcgacttagaattaattaaaaataacactgtggaatatttaggagtaaattattat
cagccaattagagttaaagctaaagaaaatatgccaaatccatatggagtatttacacct
aattggttttatgatgagtatattatgccaggcagaagaatgaatccttatagaggatgg
gagatatacgaaaggggaatatatgacataatgataaatttaagagataattatggcaat
atagggtcttttatttcggaaaatggaatgggagttgaaggagaagagcgttttataaaa
gatggaattatccaagatgattacaggatagagtttataaaagaacatttgaagtggctc
cataaagcaattgaagagggatgcaatgtaaaaggatatcatttatggacttttatggac
aactggtccttcttaaatgcatataaaaaccgttacggtcttgtatctgtcgatctaaaa
acacagaaaagaactataaagaaaagtggatattggtataaagaattatccgaaaacaat
ggatttgttgattaa

DBGET integrated database retrieval system