KEGG   Thermoanaerobacter pseudethanolicus: Teth39_1992Help
Entry
Teth39_1992       CDS       T00649                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tpd  Thermoanaerobacter pseudethanolicus
Pathway
tpd00010  Glycolysis / Gluconeogenesis
tpd00030  Pentose phosphate pathway
tpd00051  Fructose and mannose metabolism
tpd00680  Methane metabolism
tpd01100  Metabolic pathways
tpd01110  Biosynthesis of secondary metabolites
tpd01120  Microbial metabolism in diverse environments
tpd01130  Biosynthesis of antibiotics
tpd01200  Carbon metabolism
tpd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Teth39_1992
   00030 Pentose phosphate pathway
    Teth39_1992
   00051 Fructose and mannose metabolism
    Teth39_1992
  Energy metabolism
   00680 Methane metabolism
    Teth39_1992
Enzymes [BR:tpd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Teth39_1992
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Teth39_1992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3 CbiX
Motif
Other DBs
NCBI-ProteinID: ABY95618
JGI: Teth391992
UniProt: B0KD99
Position
complement(2046004..2047092)
Genome map
AA seq 362 aa AA seqDB search
MSKITLTVIKADVGGFVGHTDVHPELLEIAKKHLKEKGKMLIDFHVTRVGDDIELIMTHR
EGIDNEEVHKLAWDALWSCGEKAKELKLYGAGQDLLKDSFSGNIKGLGPGVAEMEIEERK
SEPVIIFMADKTEPGAWNLPLYKMFADPFNTVGLAIDPNMHQGFKFEVYDMIGHKKIIFE
TPEDIYDMLVFIGATGRYCIRRVYTKNNEIAAVSSTQRMNFMAGKYIGKDDPVLIVRCQN
GLPAVGEALEPFANPYLVAGWMRGSHNGPMIPVSLEDAVPTRFDGPPRVCALGFQLAEGK
LIGPQDFFKDVAFDNAREKALEIADYIRKMGPFEPHRLPLEELEYTTLPHVVKKLQGRWK
EE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaataactttaactgtgattaaagcagatgttggtggctttgtagggcataca
gacgtacatcctgaacttcttgaaatcgctaagaaacatttaaaagaaaaagggaaaatg
ctcattgactttcatgtgactagagtaggagatgacattgaacttataatgactcataga
gaaggaatagataacgaagaagttcataaacttgcatgggatgcactttggtcttgtggt
gagaaagctaaagaacttaaattgtacggtgcaggacaagatttgttgaaagattcattt
tcaggcaatataaaggggttaggaccgggagttgcagagatggaaattgaagaaagaaaa
agtgagcctgtcataatttttatggctgataaaacagagccaggagcatggaatttacca
ctttacaagatgtttgcagatccttttaatacagtaggacttgcaattgaccctaatatg
caccaaggatttaaatttgaagtttatgatatgattgggcataaaaaaataatatttgaa
actccagaagatatttatgatatgctggtctttattggagcgacaggacgatattgcata
cgaagagtgtatacaaaaaacaatgaaattgcagcagtgtcttctactcaaagaatgaat
tttatggcggggaagtatataggaaaggatgaccctgtacttattgtgagatgccaaaat
ggtcttccagcagtaggtgaagcgttggaaccttttgctaatccctatcttgttgctggt
tggatgagggggtctcataatggacctatgatacctgtttcattggaagatgctgtgcct
accagatttgatgggcctccaagagtatgcgcacttggttttcaattagcagagggtaag
cttattggcccgcaggacttctttaaagatgttgcttttgacaatgcaagggaaaaagcg
ttagaaatagccgattacataagaaagatgggaccctttgagcctcacaggttgccttta
gaggaattggaatacactaccctacctcatgttgttaaaaaacttcaagggagatggaag
gaagaataa

DBGET integrated database retrieval system