KEGG   Thermofilum pendens: Tpen_0002Help
Entry
Tpen_0002         CDS       T00446                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tpe  Thermofilum pendens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tpen_0002
Enzymes [BR:tpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Tpen_0002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(887..1984)
Genome map
AA seq 365 aa AA seqDB search
MSAYKLDEKSLNVLKEITEIVAPSGFEEPVLERIKQYYSEYADEVRRDNLGSLILVKRGS
SERPKVLVAGHVDEVGFLVTGITPEGFITFTTLGGWFEQVLLAQRVVIRTKKGEVYGVIT
SKPPHLLTPEERQKVVQFSQMYIDVGATSKEEVEKLGVRIGDPVAPWSPFTRTAFEDRIM
AKALDDRVGAFIAMEVLKHLRLNGIDHPNTLYAAATVQEEVGLRGAETVGWVADHDVAIV
TEVDIAGDVPGIKPSEAPAKLGKGPSIIVYDRSMIPNPRFKEFVIEVAEEAKIPYQLSAV
SGGTDAGRLHLYKGGRPSIVIGVPTRHIHSHVSIVSLSDVENAVRLVLELVKRLDQETLK
RFVNI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagcgtacaaattagatgaaaaatccctgaacgttttaaaagagataacggagata
gtggcgccttccggcttcgaggagcccgtcctcgagaggataaagcagtactactcggag
tacgcagacgaggtgagacgcgataaccttggctcgctgatcctcgtcaagaggggttcg
agcgagaggcccaaggttcttgtcgctggtcacgtggacgaagtgggcttcctcgtaacg
gggataacccccgaaggtttcatcacgttcaccacgctgggaggctggtttgagcaggtt
ctcctggctcagcgggtcgtcataaggacgaagaagggggaggtctacggcgtcattacg
agcaagcctccgcacctgttgacaccggaggagaggcagaaggtcgtccagttcagccag
atgtacatcgacgtcggcgctacgagcaaggaggaagtagaaaagctaggtgtaagaata
ggggacccggtggcgccgtggtctcccttcacgaggaccgcgttcgaggacagaatcatg
gcgaaagctttggacgacagagtgggggctttcatagcgatggaggtcctcaagcacctc
aggcttaacggtattgaccacccgaacacgctctacgcggctgcaactgtgcaggaggag
gttgggcttaggggcgccgagactgttggatgggtggcagaccacgacgtagccatagtt
acggaggtagacatagccggcgatgtgccggggataaagcctagcgaggctccggctaaa
ctcgggaagggaccgtccataatcgtgtacgacaggtcgatgatacctaatcctcgcttc
aaggagttcgtcatagaggtcgccgaggaggcaaagatcccctaccagctatcggctgtg
agtggcggcacggatgccggcaggcttcacctttacaagggaggaaggcccagcattgtg
ataggcgtgcccactaggcatatacacagccacgtcagcatcgtgagtctgagcgacgtg
gagaacgccgttcgactagtgctggaactcgtgaagcggctggaccaggaaaccctaaaa
aggttcgtgaatatatag

DBGET integrated database retrieval system