KEGG   Thermofilum pendens: Tpen_0002Help
Entry
Tpen_0002         CDS       T00446                                 

Definition
(GenBank) Cellulase
Organism
tpe  Thermofilum pendens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(887..1984)
Genome map
AA seq 365 aa AA seqDB search
MSAYKLDEKSLNVLKEITEIVAPSGFEEPVLERIKQYYSEYADEVRRDNLGSLILVKRGS
SERPKVLVAGHVDEVGFLVTGITPEGFITFTTLGGWFEQVLLAQRVVIRTKKGEVYGVIT
SKPPHLLTPEERQKVVQFSQMYIDVGATSKEEVEKLGVRIGDPVAPWSPFTRTAFEDRIM
AKALDDRVGAFIAMEVLKHLRLNGIDHPNTLYAAATVQEEVGLRGAETVGWVADHDVAIV
TEVDIAGDVPGIKPSEAPAKLGKGPSIIVYDRSMIPNPRFKEFVIEVAEEAKIPYQLSAV
SGGTDAGRLHLYKGGRPSIVIGVPTRHIHSHVSIVSLSDVENAVRLVLELVKRLDQETLK
RFVNI
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagcgtacaaattagatgaaaaatccctgaacgttttaaaagagataacggagata
gtggcgccttccggcttcgaggagcccgtcctcgagaggataaagcagtactactcggag
tacgcagacgaggtgagacgcgataaccttggctcgctgatcctcgtcaagaggggttcg
agcgagaggcccaaggttcttgtcgctggtcacgtggacgaagtgggcttcctcgtaacg
gggataacccccgaaggtttcatcacgttcaccacgctgggaggctggtttgagcaggtt
ctcctggctcagcgggtcgtcataaggacgaagaagggggaggtctacggcgtcattacg
agcaagcctccgcacctgttgacaccggaggagaggcagaaggtcgtccagttcagccag
atgtacatcgacgtcggcgctacgagcaaggaggaagtagaaaagctaggtgtaagaata
ggggacccggtggcgccgtggtctcccttcacgaggaccgcgttcgaggacagaatcatg
gcgaaagctttggacgacagagtgggggctttcatagcgatggaggtcctcaagcacctc
aggcttaacggtattgaccacccgaacacgctctacgcggctgcaactgtgcaggaggag
gttgggcttaggggcgccgagactgttggatgggtggcagaccacgacgtagccatagtt
acggaggtagacatagccggcgatgtgccggggataaagcctagcgaggctccggctaaa
ctcgggaagggaccgtccataatcgtgtacgacaggtcgatgatacctaatcctcgcttc
aaggagttcgtcatagaggtcgccgaggaggcaaagatcccctaccagctatcggctgtg
agtggcggcacggatgccggcaggcttcacctttacaagggaggaaggcccagcattgtg
ataggcgtgcccactaggcatatacacagccacgtcagcatcgtgagtctgagcgacgtg
gagaacgccgttcgactagtgctggaactcgtgaagcggctggaccaggaaaccctaaaa
aggttcgtgaatatatag

DBGET integrated database retrieval system