KEGG   Thermofilum pendens: Tpen_0093Help
Entry
Tpen_0093         CDS       T00446                                 

Definition
(RefSeq) putative thymidine phosphorylase
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
tpe  Thermofilum pendens
Brite
Enzymes [BR:tpe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Tpen_0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(73057..74619)
Genome map
AA seq 520 aa AA seqDB search
MVPVFEVVWMKLKTRILPFESAHYTVVLDQSVAKKLDVRPSDRVLVRFNGKTVVAIANIA
KEFSHEHVGVYVNIAKALGISDGDEVEVEATSPPASLQAIRKKLQGLSLESDEIYQVVKD
IVDGKLSELELAAFVTAVHFQGMTPSEIYSFTLSMVETGQRLRLKRKPILDKHSLGGVPG
DKTSLLVVPIIASLGFTIPKTSSRAITSAAGTADRMEVLAPVNLSIDEIERIVEKTNACL
VWGGALNLAPADDIIIRVEYPLGIDPFYIPSILAKKLAVGSTHVVLDVPTGRGTKVKTLE
EAKRISQSFFEIARMFGMNLQAVATYAEEPIGHAIGPALEAREALIALRELRPGDLVDKA
ASLAGTLLEMVGVENGYETAMEALRTGKAEKKLREIIEAQGGDPDVTPEEIPLGDKTYTL
YSEEDGFVYYIDNSLLANIGKIAGAPIDKGAGVYIHVKLGEKVRKGDPLLTVYSSSSAKL
QAVERILEDSKPVLVGRTAGRRMLLERIQYQPPRQLVLER
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggtccccgtcttcgaggtggtctggatgaagctcaaaacgaggatccttccgttcgag
tctgcccactacacagtcgtgctcgatcagagcgtggcgaagaaactcgacgtgaggcct
agcgacagagtacttgtacgtttcaacgggaaaaccgtggtagcgatagctaacatagcg
aaagagttttcccacgaacacgtgggagtctacgtaaacatagcgaaagcgctggggata
tcggacggagacgaggtcgaagtagaggccacaagtccgccggcatccctgcaggcaata
aggaagaaactacagggcttgagcctcgaatccgacgagatataccaggtagtaaaggac
atagtggatggaaagctgagcgagctcgagctcgcagccttcgtgaccgcggtacatttc
caggggatgaccccgtctgagatatactcctttacgctctcaatggtcgagacggggcag
aggttaaggcttaaaaggaagcctatactcgacaagcacagccttggcggtgttcccggg
gataagacgagcctcctcgtagtaccgataatagcttccctgggcttcacaattcctaag
acctcctcgagggccataacctccgccgccgggacggccgatagaatggaggtgctggcg
ccggtcaacctgtcgatagatgaaatcgagagaatagtcgagaagacgaatgcgtgcctc
gtctggggaggagccctgaacctagcccctgctgacgacatcataattagggtcgagtac
cccctcgggatagaccccttctacatcccgtccatcctcgcaaagaagcttgcagtaggg
tctacgcacgtcgttttagacgtgcccacaggtaggggtacgaaggtgaagacgctagaa
gaggcgaagagaatctctcaaagtttcttcgaaatagccaggatgttcggcatgaacctg
caagcagtagcgacgtacgcggaggagcccattgggcacgcgataggtccagctctcgaa
gctcgtgaagctttaatcgcgttgcgagagctacggccgggggacctcgtcgacaaagcg
gcgagcctggcgggcactctcctggaaatggtgggggtggagaacggttacgaaacggct
atggaagctctgagaacggggaaggccgagaagaagctccgggagataatcgaggcccag
ggcggagacccagacgttacccccgaagagataccgctgggagacaagacgtacacactg
tactcggaggaggacggcttcgtatactacatcgacaactcgttgctggcgaacataggt
aagattgccggggcaccgatagacaagggcgccggggtatacatccacgtcaagctgggc
gagaaggtcaggaagggagaccccctgcttacagtctactcttcgagctcggcgaagctt
caagcggtggaaagaatcctcgaagactctaagccggtgcttgtagggcggactgccggc
aggagaatgctcttagagaggattcagtaccagcctccgagacagctggtattggagaga
tga

DBGET integrated database retrieval system