KEGG   Thermofilum pendens: Tpen_0177Help
Entry
Tpen_0177         CDS       T00446                                 

Definition
(GenBank) Cellulase
Organism
tpe  Thermofilum pendens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
152495..153514
Genome map
AA seq 339 aa AA seqDB search
MVETSLLSKLANAPAPSGFENRVREIIAEELEELGYEPVTDSLGNLYVVLGEGRPSLVLA
AHMDEVGFIVTHVTEDGFLRVAPLGGVVAEGLPGQEVVVLTDEGLVEGVIGATPPHLRGA
TQKELTVEEIFIDIGVLSREEARSKGVDVGSPVTFAGNFKERGDAVISKALDDRVGCYAL
LEALRSGATPKKGSVVVAFTVQEEVGLRGSSALAKALEPNFAVAVEGTIANDTPGTPPEK
VVTRLGRGPAVRLMDKSMIASMELYKHIKALAESKSIPYQVQISPYSGTDAGSFAVHGAA
VSAVSVPVRYIHSPASLALKKDVDATVELLKALIEEPFP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaaactagcctgttgtcaaagttggctaacgccccggcgcctagcggcttcgag
aatagagttcgagagataatcgcggaggagcttgaagagctgggctacgagcctgtaacg
gactcccttggaaacctgtacgtggtgctcggagagggtaggccgagcctggttttagcg
gcgcatatggacgaggtaggctttatagtcacgcacgtaacggaggacgggttcttgagg
gtagccccgctaggcggggtagtcgcggaggggcttcccggtcaggaggtggtcgtgctg
acggatgaggggcttgtcgagggggttataggggctactcctccgcatctacggggggct
acccagaaggagctaacagtggaggagattttcatagatataggagtcttgtcccgggag
gaggcgcgctccaagggtgtggacgttggttcgcctgtaaccttcgcggggaacttcaag
gagagaggcgatgcagtgataagcaaggcgctcgacgaccgcgtcgggtgctacgcgttg
ctggaggccctgagaagcggggctactccgaagaagggtagcgtcgtcgtagcgttcaca
gtgcaggaggaggtcgggctgaggggatcctccgcgctcgcgaaggctctagagccgaat
ttcgccgtagccgtcgagggaaccattgctaacgataccccgggaactcctccagagaag
gttgtcaccaggctgggcagaggtcccgccgtacgcttgatggataaatcgatgatagca
agcatggagctttacaagcacatcaaggcgctagcggagtcgaagtccattccgtaccag
gtgcagatatccccctatagcgggacggacgctgggagcttcgccgttcacggcgccgct
gtcagcgcagtctccgtgcccgtaaggtacattcactcgccagcctccctggccttgaag
aaggatgtagacgccacagtagagctgttgaaggctctgatcgaagagccgttcccctga

DBGET integrated database retrieval system