KEGG   Thermofilum pendens: Tpen_0196Help
Entry
Tpen_0196         CDS       T00446                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tpe  Thermofilum pendens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpen_0196
   01230 Biosynthesis of amino acids
    Tpen_0196
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0196
   00030 Pentose phosphate pathway
    Tpen_0196
   00051 Fructose and mannose metabolism
    Tpen_0196
  Energy metabolism
   00680 Methane metabolism
    Tpen_0196
Enzymes [BR:tpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Tpen_0196
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Tpen_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(173781..174887)
Genome map
AA seq 368 aa AA seqDB search
MRITVSLIKADVGGLAGHVVVHPKLEELARKRLEEARETGLLIDFYVYHVGDDLQLLMTH
TKGENNAEIHKLAWDIFVEVTEKVSKPLKLYGAGQDLLKDTFSGNIKGMGPGCAEMEFEE
RRSEPILVFSADKTEPGAWNYKLYRIFADPFNTAGLIIDPAMHSGFIFEVVDVYEHKSVK
LSTPEESYDLLALIGTPGRYVVKRVYRKSDGEIAAVSSATRLSLIAGRYVGKDDPVLIIR
AQHGFPATGEVLEAFAFPHLVAGWMRGSHTGPLMPVPLRYAQCTRFDGPPRVVGLGFQLH
DGRLEGPVDLFDDPAFEMTRRMAEEVADYMRRHGPFMPHRLGPEEMEYTTLPSVLEKLKA
RFVPAEAE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagaataacagttagcttaataaaggctgacgttggagggctggcgggacacgtagta
gttcaccccaagctcgaagagcttgcgaggaaaagactggaggaggcccgcgaaacaggt
ctcctcatagacttctacgtgtaccatgtaggcgacgacctccagttgctcatgacgcac
acgaagggcgagaataacgccgagatacacaagctagcctgggacatattcgtcgaggta
accgagaaggttagcaagccgctcaaactgtacggggccgggcaggaccttctcaaggac
acgttctccggaaacatcaaggggatggggcccggttgcgcggagatggagttcgaggag
aggaggagtgagcctatactagtgttctccgccgataagacagagccgggggcgtggaac
tacaagctctatagaatcttcgctgacccgtttaacactgctgggctgataatagaccca
gctatgcacagcggctttatattcgaggttgtagacgtctacgagcacaaatcagtcaag
ctgtcaacgcccgaagagagctacgacctcctagctttgataggcactcccgggcgatac
gtggtgaagcgtgtctacaggaagtccgacggggagatagccgcggtatcttcggcgacc
cgtctgagcctcatagccggaaggtacgttgggaaggacgaccccgtactcataattagg
gctcagcacggcttcccggctacaggcgaggttctagaggcgttcgctttcccgcacctg
gtcgccgggtggatgcgcggtagccacactggtccgctgatgcccgtaccgctcaggtac
gcacagtgcacacgcttcgacgggccgccgcgagtcgtcgggctcggcttccagcttcat
gacggtcgactcgagggacccgttgacctgttcgacgaccccgcgttcgaaatgacgagg
agaatggcggaggaagtagcggactacatgagacgccacggcccattcatgccgcacagg
cttggccccgaagaaatggagtacacgacccttccatccgtgctggagaagcttaaggct
aggtttgtacccgcggaggcagagtag

DBGET integrated database retrieval system