KEGG   Thermofilum pendens: Tpen_0316Help
Entry
Tpen_0316         CDS       T00446                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tpe  Thermofilum pendens
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpe01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tpe00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(279985..281193)
Genome map
AA seq 402 aa AA seqDB search
MMTVDVVQSLVELVKIPSEVYYEGNRIVRRYYREAAEAVARLAETHGLRVEKVDLEGGEI
PTVIASLPGKASGKPSVAFVTHYDVVPAKGPWVVEGRTMDPYSPLVLDGKVYGRGAADDK
SGIVATIAGLVDIREAGIEPRYNPVVVVTGDEEVGGTGIRRLLEKGYRWDYVIIVDSGSE
YVSVGASGVVHGWIKVKGKSGHAGYPHVARNAVEDLVRVLGELMELKTVRGARLSKYPSP
PGSPVPYVWGRLTFNILRLPPTEPEKHNRIPGEAWCGFDMRLLPEEDVEEAVRELYAKLS
SIAMKLGVSLEVEIIGKQKGWYSKNEAFVREVLTAAGRSKGREVPVAAELGGNDGTFFDE
YGMDVVAFGTIREGTNIHSEGEHVYVEDIEAFRKFMYEFLKP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacagtggacgttgtacagtcattggtagaacttgtgaagattccctccgaggtt
tactacgaaggaaaccggatagtaaggaggtactaccgggaagctgctgaagccgttgcg
cgcctagccgaaactcatggcttgagggttgaaaaagtggatctcgagggaggcgagatc
cctacagttattgcgtcgcttccaggtaaggcatccggcaaaccatcggtcgcgttcgtt
acgcactacgacgttgtaccagcaaagggtccttgggtagttgaaggaaggactatggac
ccctactcccccctggttctagacgggaaggtctacggaaggggggctgcagacgacaag
tcggggatagtcgcgacgatcgccgggcttgtagacatcagggaggcgggcattgagccg
agatacaaccccgtggtcgtggtcacaggggacgaggaagtggggggaacgggtattagg
cggcttctcgagaagggctaccggtgggactacgtgatcatagtggatagcgggtcagag
tacgtttcggtaggcgcgagcggcgttgtgcacgggtggataaaggtcaaggggaaatcg
gggcacgccggctacccccacgttgctaggaacgccgtcgaggacctcgtgagggttctg
ggcgagcttatggagctcaagactgtgcgaggagcaaggctctcgaagtatccgtcgcct
cccgggagcccggtgccctacgtatggggaagacttactttcaatatactaaggttgcct
cccacggagcctgaaaaacacaacaggattcccggcgaggcgtggtgcgggttcgacatg
aggctcctaccggaggaggacgtcgaggaagctgtgagagagctttacgccaagctctcg
tccatcgcgatgaagcttggagtgtccttggaggtagagataatagggaagcagaaaggc
tggtattcgaagaacgaggcgttcgttcgggaggtgctaacggctgctgggagaagcaag
ggccgcgaggttccggtagcggcggagcttggcggtaacgatggaacgtttttcgacgag
tatggaatggacgtcgtagcttttggcactatacgcgaaggtacaaacatacactcggag
ggggagcacgtatacgtagaagacatcgaggcattccgaaagttcatgtacgagttcctc
aaaccttag

DBGET integrated database retrieval system