KEGG   Thermofilum pendens: Tpen_0316Help
Entry
Tpen_0316         CDS       T00446                                 

Definition
(GenBank) peptidase M20
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tpe  Thermofilum pendens
Pathway
tpe00300  Lysine biosynthesis
tpe01100  Metabolic pathways
tpe01120  Microbial metabolism in diverse environments
tpe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tpen_0316
Enzymes [BR:tpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tpen_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 EKR
Motif
Other DBs
NCBI-ProteinID: ABL77725
JGI: Tpen0316
UniProt: A1RWZ5
Position
complement(279985..281193)
Genome map
AA seq 402 aa AA seqDB search
MMTVDVVQSLVELVKIPSEVYYEGNRIVRRYYREAAEAVARLAETHGLRVEKVDLEGGEI
PTVIASLPGKASGKPSVAFVTHYDVVPAKGPWVVEGRTMDPYSPLVLDGKVYGRGAADDK
SGIVATIAGLVDIREAGIEPRYNPVVVVTGDEEVGGTGIRRLLEKGYRWDYVIIVDSGSE
YVSVGASGVVHGWIKVKGKSGHAGYPHVARNAVEDLVRVLGELMELKTVRGARLSKYPSP
PGSPVPYVWGRLTFNILRLPPTEPEKHNRIPGEAWCGFDMRLLPEEDVEEAVRELYAKLS
SIAMKLGVSLEVEIIGKQKGWYSKNEAFVREVLTAAGRSKGREVPVAAELGGNDGTFFDE
YGMDVVAFGTIREGTNIHSEGEHVYVEDIEAFRKFMYEFLKP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacagtggacgttgtacagtcattggtagaacttgtgaagattccctccgaggtt
tactacgaaggaaaccggatagtaaggaggtactaccgggaagctgctgaagccgttgcg
cgcctagccgaaactcatggcttgagggttgaaaaagtggatctcgagggaggcgagatc
cctacagttattgcgtcgcttccaggtaaggcatccggcaaaccatcggtcgcgttcgtt
acgcactacgacgttgtaccagcaaagggtccttgggtagttgaaggaaggactatggac
ccctactcccccctggttctagacgggaaggtctacggaaggggggctgcagacgacaag
tcggggatagtcgcgacgatcgccgggcttgtagacatcagggaggcgggcattgagccg
agatacaaccccgtggtcgtggtcacaggggacgaggaagtggggggaacgggtattagg
cggcttctcgagaagggctaccggtgggactacgtgatcatagtggatagcgggtcagag
tacgtttcggtaggcgcgagcggcgttgtgcacgggtggataaaggtcaaggggaaatcg
gggcacgccggctacccccacgttgctaggaacgccgtcgaggacctcgtgagggttctg
ggcgagcttatggagctcaagactgtgcgaggagcaaggctctcgaagtatccgtcgcct
cccgggagcccggtgccctacgtatggggaagacttactttcaatatactaaggttgcct
cccacggagcctgaaaaacacaacaggattcccggcgaggcgtggtgcgggttcgacatg
aggctcctaccggaggaggacgtcgaggaagctgtgagagagctttacgccaagctctcg
tccatcgcgatgaagcttggagtgtccttggaggtagagataatagggaagcagaaaggc
tggtattcgaagaacgaggcgttcgttcgggaggtgctaacggctgctgggagaagcaag
ggccgcgaggttccggtagcggcggagcttggcggtaacgatggaacgtttttcgacgag
tatggaatggacgtcgtagcttttggcactatacgcgaaggtacaaacatacactcggag
ggggagcacgtatacgtagaagacatcgaggcattccgaaagttcatgtacgagttcctc
aaaccttag

DBGET integrated database retrieval system