KEGG   Thermofilum pendens: Tpen_0509Help
Entry
Tpen_0509         CDS       T00446                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tpe  Thermofilum pendens
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tpen_0509
Enzymes [BR:tpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Tpen_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
462868..463797
Genome map
AA seq 309 aa AA seqDB search
MYGALELYSRSVSPKLFGNECSFEESAYVVVGAPFDSTATGVPGQRFAPQRIREVSVELE
TFLPDLQIDVERLAVNDAGDLPVLTSVEALIDILGGVAREVLSSGKGLIMLGGDHFSSFP
VLVEAAGNVDELGVLVFDAHLDLRDEYPVKCRYSHATVFRRLIEQTKNVYIAYYKPRGWS
SEEYEFMRQSPRKLAVLNTREEVESWVKEHRTVYVSIDIDALDPAYAPGTGTPEPIGLAP
RELVDSLRAAVLGSEKLLGIDVVEVNPLVDVNNLTSRVAAKILLEALAAMYEARKIGACT
RTSKHFLNG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtatggagcattggagctttactcgcggagtgtgtctccaaagctcttcggaaacgag
tgtagctttgaagagagtgcttacgtcgtcgtgggtgctccttttgactcaacggcgacc
ggtgtacccggacaaaggtttgcgcctcaaagaatacgtgaagtctcggtagagctcgaa
acctttcttcccgacttgcaaatagatgtagagcgcctcgccgtcaacgatgctggagac
ctacccgtattaaccagcgtagaagccttgatagatatcctgggcggagtcgccagggaa
gtcttgtcgtccgggaaagggctcatcatgctcggtggggaccatttctcgtccttcccc
gtcctcgttgaagcagcaggcaacgtggacgaactaggcgtgctcgtcttcgatgcccac
ctagatcttcgagacgaataccccgtcaagtgcaggtacagccatgctacggtcttccgc
cggttaatcgaacaaacgaaaaacgtatacatcgcgtactacaagccgcgcggatggagc
agcgaagagtacgaattcatgcgtcaatcgcccaggaagctcgccgttctaaacacccgg
gaagaggtagaaagctgggtaaaggagcacaggacggtatacgtatctatcgatatcgat
gcattggaccccgcgtatgcccccgggacgggtactcctgaacctatcggcctcgctccc
agggagctcgttgactccctacgcgcggcggttctcggctcagaaaaactcctaggaata
gacgtagtagaggttaacccgctagtggatgttaacaacttgacgtcaagggttgccgcg
aaaatactactcgaagcactcgcagccatgtacgaggctaggaagataggcgcctgcacg
cgaacttctaaacacttcttaaacggttaa

DBGET integrated database retrieval system