KEGG   Thermofilum pendens: Tpen_0516Help
Entry
Tpen_0516         CDS       T00446                                 

Definition
Fis family transcriptional regulator (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tpe  Thermofilum pendens
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpen_0516
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tpen_0516
   00640 Propanoate metabolism
    Tpen_0516
   00660 C5-Branched dibasic acid metabolism
    Tpen_0516
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tpen_0516
Enzymes [BR:tpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tpen_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
468694..469812
Genome map
AA seq 372 aa AA seqDB search
MIPYEFEVKDIFEKFQVPVEKSCLLTHEALKDSLGCIKGLRTPLIVKAQVRGWGRGKAGL
VKSAENPEEALKVAQEFFLREFNGEKIRYVLVSERKRILREMYLSFMVSSNPPGFLLLAS
KHGGVDVEELSKTPGGLLKIFIDPFEGLRDYMVRTVAGYLGVPQEHIEKILRSLWQIFRE
YNFTLLEVNPLALTEDGVLALDRKGVIDDDASRKSSLTGIFARYFSELDELSLSAFQKGF
SVVKLDGDTAVVGNGAGLTMATLDAVLEAGARPGLFLDLGGGADAERVREALLLVLKQQN
ISKILLNILGGITRCDEVARGVVQALSSAKPSSVKVAVRLSGFMEDEGRRILREAGLSAF
DSLEEAVASLLG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgattccttacgagtttgaagtgaaagatattttcgagaagttccaagttcccgtcgag
aagtcctgcctgctaactcacgaagctttgaaggattccttgggatgcataaagggcctg
agaacacctttgattgttaaagcgcaggttcgcggatggggtagagggaaggcggggtta
gtgaaaagcgccgagaaccccgaggaggctttgaaggttgcgcaggaattcttccttcga
gagtttaacggagagaagataaggtacgtgctggtgtctgagagaaagaggatactcagg
gaaatgtacctgtcctttatggtttcctctaaccctccggggttcctactgctggcatcc
aagcacggtggtgttgacgtcgaagaactttcgaaaactcctggaggattgctgaaaata
ttcatagacccctttgaggggttgcgggactacatggttagaacggttgcgggttatctc
ggtgtgccgcaggagcacatagagaagattttgagaagcctttggcagatattcagagag
tacaacttcaccttgctcgaggtaaaccctctagcgctaaccgaggatggggtactggct
ctcgacaggaagggagtcatagatgatgatgcctctaggaaaagctccctgacggggatc
ttcgcgcgctacttctcggagctcgacgagcttagcctctcggcattccagaaggggttc
tccgtcgtgaagctcgacggagacactgccgtggtgggcaatggcgccgggctgaccatg
gctacgcttgacgccgttctcgaggcgggtgcaaggccagggcttttcctagacttgggc
gggggagctgacgccgagagagtcagggaggccctcctactcgtactgaaacagcagaac
atttcgaagatcctcctgaacatcttgggagggataacccggtgcgacgaggtggccaga
ggagtagtacaagccttgtcgtccgctaaaccgagtagcgtgaaagtagccgtgaggctt
tccggtttcatggaggacgagggcaggaggatactgagagaggcgggtctaagcgcgttt
gatagcctggaagaagctgtagcgagcttgttaggctga

DBGET integrated database retrieval system