KEGG   Thermofilum pendens: Tpen_0541Help
Entry
Tpen_0541         CDS       T00446                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tpe  Thermofilum pendens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpen_0541
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0541
   00020 Citrate cycle (TCA cycle)
    Tpen_0541
   00620 Pyruvate metabolism
    Tpen_0541
   00640 Propanoate metabolism
    Tpen_0541
   00650 Butanoate metabolism
    Tpen_0541
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tpen_0541
   00680 Methane metabolism
    Tpen_0541
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tpen_0541
Enzymes [BR:tpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tpen_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
491573..491836
Genome map
AA seq 87 aa AA seqDB search
MSGTASKLLAKPVVGAVAAGSWRTERPVVDMSKCRLCGVCWLYCPDGVIEIDEDARLVKI
DYDYCKGCGVCAAECPFKAISMVREHE
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgggcactgcgagtaagcttctggctaaaccggtagttggggctgttgcagcgggt
agctggcgcaccgagaggcccgtcgtagacatgtctaagtgtaggctgtgcggggtctgc
tggctctactgccccgacggagttatagagatcgacgaggatgcaaggctcgttaagata
gactacgactactgtaaaggttgcggtgtatgcgccgctgaatgccccttcaaggctata
agcatggtgagggagcatgagtga

DBGET integrated database retrieval system