KEGG   Thermofilum pendens: Tpen_0542Help
Entry
Tpen_0542         CDS       T00446                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tpe  Thermofilum pendens
Pathway
tpe00010  Glycolysis / Gluconeogenesis
tpe00020  Citrate cycle (TCA cycle)
tpe00620  Pyruvate metabolism
tpe00633  Nitrotoluene degradation
tpe00640  Propanoate metabolism
tpe00650  Butanoate metabolism
tpe00680  Methane metabolism
tpe00720  Carbon fixation pathways in prokaryotes
tpe01100  Metabolic pathways
tpe01120  Microbial metabolism in diverse environments
tpe01130  Biosynthesis of antibiotics
tpe01200  Carbon metabolism
Module
tpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0542
   00020 Citrate cycle (TCA cycle)
    Tpen_0542
   00620 Pyruvate metabolism
    Tpen_0542
   00640 Propanoate metabolism
    Tpen_0542
   00650 Butanoate metabolism
    Tpen_0542
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tpen_0542
   00680 Methane metabolism
    Tpen_0542
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tpen_0542
Enzymes [BR:tpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tpen_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABL77948
JGI: Tpen0542
UniProt: A1RXL8
Position
491829..492995
Genome map
AA seq 388 aa AA seqDB search
MSDGGKRILLTGNYAAAYAARDADPDVVSAYPITPQTPVIEKIADFIASGELNAKFVRVE
SEHSAMAALIGAASAGARTYTATSSQGLFYMYEVVWWAAGARLPIVMGIVTRALGPPWNI
WSEHSDFYAIRDSGWNMFFASSAQEVYDLTLISYGVSENPDVLLPSAVGWDAFEVSHTYE
PVHVLGREEASKILPPKGAWKPPLTPEDPSSLGNLAYPEEYAEVRRTLREASEKALGVFR
EVATRYSRITGRNYAGLYECYRCVDADALIIGMGSIIGEVYRAVDLLRERGERVGALKLW
VYRPFPYEEVARRLENVKLVVTVARASVFGSLSPLGLDVASAITLGGLDVKLVDYAAGVG
GVDVYAEDVVGMYEKAKASRSGGFWWVR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgggggaaagaggatactcttaacgggtaactacgctgccgcctacgccgct
agggacgcggaccccgacgtcgtctccgcgtaccccatcactcctcagacccccgttatc
gagaagatagccgacttcatagcatcgggagagctaaacgcgaagtttgtacgcgtagag
tcggagcacagtgcgatggcggcactgataggagctgcgagcgcgggggccaggacgtac
acggcgacttccagccagggtcttttctacatgtacgaggtggtatggtgggcggcggga
gccaggttgcccatagtgatgggcatagttacgcgcgctcttggacctccctggaacatt
tggagcgaacactcggacttctacgccataagggatagcggctggaacatgttcttcgcg
tcgagcgcacaggaggtttacgacttgacgctgatctcgtacggcgtctccgagaatccc
gacgtgttgcttccctccgcggtcggctgggacgccttcgaagtgagtcatacgtacgag
cctgtccacgtgcttgggagggaggaggcatcaaaaatcctgcctcccaagggtgcctgg
aagccgccgctgacgcccgaggatccctcctctctcgggaacctagcctacccggaggag
tacgcggaggtcaggcggaccctgagggaggcctccgagaaagccctcggagtgttcaga
gaggttgcaaccaggtactcgaggatcacggggaggaactacgcggggctctacgagtgc
tacaggtgcgtcgacgcggacgcgcttataatagggatgggctccataataggggaggtc
tacagggctgtcgatctcctcagggagaggggcgagagggttggagctctaaagctctgg
gtctacaggcctttcccatacgaggaagtcgccaggaggctggaaaacgtcaagctcgta
gtaaccgtagcgagagcctccgtgtttggtagcctctcccccctcggcttagacgttgcc
tcggcgatcacgctaggaggtctcgacgtgaagctcgtggactacgcggcgggcgtcggc
ggagtggacgtctacgcggaggacgtggtggggatgtacgaaaaggctaaggcttcgaga
agcgggggtttctggtgggtgaggtga

DBGET integrated database retrieval system