KEGG   Thermofilum pendens: Tpen_0543Help
Entry
Tpen_0543         CDS       T00446                                 

Definition
thiamine pyrophosphate binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
tpe  Thermofilum pendens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpen_0543
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0543
   00020 Citrate cycle (TCA cycle)
    Tpen_0543
   00620 Pyruvate metabolism
    Tpen_0543
   00640 Propanoate metabolism
    Tpen_0543
   00650 Butanoate metabolism
    Tpen_0543
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tpen_0543
   00680 Methane metabolism
    Tpen_0543
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tpen_0543
Enzymes [BR:tpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tpen_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
492997..493899
Genome map
AA seq 300 aa AA seqDB search
MSHKAFPREEYILKGHAACPGCGATLLLRHVLKALGPNTYLVIPACCTSVIAGPHPRSAF
KVPVLHIAFAASAAAASGMVEALEKLGKPANVVVWAGDGGTVDIGLQALSGAAERGHNLI
YICYDNEAYMNTGIQKSGSTPYKAWTTTTPTGNLSVKKDVPSIMVAHRVPYVATINPAYV
NDLYYKLRKAAQIKGGLKYIHAFSPCPVGWRYDSSLTVKVARLAVETGVWVLYEVENGMF
SLTGPSKALVDKSKRKPVAEYLRLQGRFSHLKEEDIAEIQRLVDEQWERIAEILREQEKG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacaaggccttcccgcgggaggagtacatactgaaggggcacgccgcgtgccct
ggttgcggcgcgacactgctactgcggcacgtactgaaagcccttggacccaacacgtac
ctggttatcccggcctgttgtacgagcgtgatagcgggaccacaccctaggtctgcgttc
aaggtgccggtgcttcacatagcgttcgctgcaagcgccgctgccgcatcaggcatggtg
gaggcgttggagaagctcgggaagcctgcgaatgtcgtcgtgtgggccggggacggcggg
acggtggacataggactccaggccttgagcggtgcggcggagagaggacacaacctcatc
tacatatgctacgacaacgaggcctacatgaacacggggattcagaagtcagggtccact
ccctacaaggcttggaccacgacgactcccactgggaatctgagtgtaaagaaagacgta
ccgtcgatcatggtggcgcaccgcgtcccctacgtggctacgataaaccctgcctacgtg
aatgacctctactacaagcttagaaaggcggcgcagataaagggagggttaaagtatatc
cacgcgttctccccctgccctgtcgggtggaggtacgactccagcttaacggtcaaggtt
gcccgcctagccgtagagactggggtgtgggttctctacgaggttgagaacggtatgttc
agccttacgggacccagcaaggccttagtagacaagagcaagaggaagcccgtcgcggag
tacttaaggcttcaggggaggttctcgcatcttaaggaggaggacatcgccgagattcaa
agactcgttgacgagcaatgggagagaatcgcggagatactacgggagcaggagaagggc
tag

DBGET integrated database retrieval system