KEGG   Thermofilum pendens: Tpen_0571Help
Entry
Tpen_0571         CDS       T00446                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
tpe  Thermofilum pendens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpen_0571
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0571
   00020 Citrate cycle (TCA cycle)
    Tpen_0571
   00620 Pyruvate metabolism
    Tpen_0571
   00640 Propanoate metabolism
    Tpen_0571
   00650 Butanoate metabolism
    Tpen_0571
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tpen_0571
   00680 Methane metabolism
    Tpen_0571
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tpen_0571
Enzymes [BR:tpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tpen_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
520961..521512
Genome map
AA seq 183 aa AA seqDB search
MRWHGRGGQGVVTSSELLALAALREGKFVYHAPEFGPERRGAPVKAYTRISREPIELHSG
IYEPSAVVVIDPSLQNDPSIASGLRKGGLIVVNAKSPGDVLLRSAQEKGAEVWYVDAYSI
AMEVFGRPFYNTPMLGAFVRASNVVSLESVVSVAMERFSKDSKLAQLNVLAIRRAYDEVK
KYE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgagatggcatgggcgtggaggccaaggcgtggttaccagcagcgagcttctcgccctg
gctgctctaagggaggggaagttcgtgtatcatgctccggagttcggtccggagaggcgg
ggcgcacccgtgaaggcttacacgcgtatatcgcgtgaaccgatagagctgcactcgggt
atctatgagcccagcgctgtggtggttatagatccttctctgcagaacgacccctccatc
gcttcggggcttaggaagggagggcttatcgttgtgaacgcgaagagccccggggacgtg
ttgctccggagtgcccaggagaagggtgctgaggtgtggtacgtggacgcgtatagcatt
gccatggaggtctttgggagacccttctacaacactccgatgctcggagcgtttgttagg
gcgagcaacgtggtgagccttgagtctgtggtttcggttgcaatggagcgtttttcgaag
gacagcaagctcgcccaactaaacgtgctcgcgattaggcgggcgtatgatgaggtgaag
aagtatgagtga

DBGET integrated database retrieval system