KEGG   Thermofilum pendens: Tpen_0572Help
Entry
Tpen_0572         CDS       T00446                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
tpe  Thermofilum pendens
Pathway
tpe00010  Glycolysis / Gluconeogenesis
tpe00020  Citrate cycle (TCA cycle)
tpe00620  Pyruvate metabolism
tpe00633  Nitrotoluene degradation
tpe00640  Propanoate metabolism
tpe00650  Butanoate metabolism
tpe00680  Methane metabolism
tpe00720  Carbon fixation pathways in prokaryotes
tpe01100  Metabolic pathways
tpe01120  Microbial metabolism in diverse environments
tpe01130  Biosynthesis of antibiotics
tpe01200  Carbon metabolism
Module
tpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0572
   00020 Citrate cycle (TCA cycle)
    Tpen_0572
   00620 Pyruvate metabolism
    Tpen_0572
   00640 Propanoate metabolism
    Tpen_0572
   00650 Butanoate metabolism
    Tpen_0572
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tpen_0572
   00680 Methane metabolism
    Tpen_0572
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tpen_0572
Enzymes [BR:tpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tpen_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_2 Fer4_10 Fer4_16 Fer4_9 Fer4_13 Fer4_8 Fer4_15 Fer4_17 Fer4_4 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ABL77977
JGI: Tpen0572
UniProt: A1RXP7
Position
521505..521801
Genome map
AA seq 98 aa AA seqDB search
MSEASSFVLKSWREMPPGGIIPVPKTSLLNKTGTWRALKPVINQAKCIRCLMCWVHCPEP
AILRGEDDSVAVDYDYCKGCGICANVCPVHAIEMVPEG
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcgtcgagttttgttttgaaaagctggagggagatgcctcccggcggcatc
ataccagtgcccaagacaagtcttctcaataagactggtacgtggcgcgccctaaaaccc
gttataaaccaggctaagtgtataaggtgtttaatgtgctgggttcactgtccagagccg
gcgatacttaggggcgaggatgactccgtggccgtggactacgactactgtaagggttgc
ggtatctgcgctaatgtttgtcccgtacatgcgatagaaatggttccagagggatga

DBGET integrated database retrieval system