KEGG   Thermofilum pendens: Tpen_0602Help
Entry
Tpen_0602         CDS       T00446                                 

Definition
CoA-binding domain-containing protein
Organism
tpe  Thermofilum pendens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
556017..558131
Genome map
AA seq 704 aa AA seqDB search
MIDERILRLLRPESVAVVGASRNPEKIGYQVVKNLLEAGFPRERIFPVNPNADEILGLKC
YKSVSEIPYQVDLVVVAVPAPAVPGVLEDAGRKGVKAVAVITSGFKEIGNVDLEQRIASI
AKNYGMRLLGPNIVGICDTVKRVNASFCQGLPKPGEIAFITQSGALGIALVGWTKLKGIG
LSDLVSIGNKADVDETDLVEFFGEDQYTKVITAYLEGVSDGRRFLEAARRVARRKPIIVL
KAGRGVRTIGAIKSHTGSLAGSFAAYEAAFKQSGILLARSFVELFDWATAFAKTHIPRGE
NVVVLTNGGGAGIMATDALEDYGIRLMDIPQDLAEKLRKHMPPFGSVFNPVDLTGMADAE
QYYGALKDLLMHDSVDAVLVLYCHTAITNPQEIAEALLRAVRETESKKTVLASFIGGEEV
NEACGKLTENGIPCYESPEKAASSLGAIYRYKHMLEKLDRRTEVAVSVDVEAARHVVRSA
LKEGRTTLTPSEAAALVGYYGIPVLAKKIAKSPEEAVRIAREIGYPVVLEVESPDILHKS
DIGGILVGLQSDAEVAEGYSKILDNVSKKAPSARVNGIIVRKMAEKGKEIALGVHRDPIF
GPLVMVGSGGVLVELYRDVSFRVAPLSLEDAYEMLEETKIYKVLKGYRGEPPSDYEKVVD
VLIRLSKLACDVEEIEDIDINPFFVYERGKGGIAVDVKVTLVQR
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgaacgtatcttgaggcttttaaggccggagagcgtagctgttgttggcgcg
tcgcggaatcccgagaagataggctaccaggtcgttaagaacctcttggaggcagggttc
ccgcgggagagaattttccccgtaaatcccaatgccgacgagatactgggcttgaagtgc
tataaatccgtctcggagataccttaccaggtcgacttggtggttgtcgcggtcccagcc
cccgccgttccgggagttctagaggacgctggtcgaaagggtgttaaggcagttgccgta
ataacgagcggcttcaaggaaattgggaacgtagacttggagcaacgcatagcgagcata
gcgaagaactacgggatgagactcctaggcccgaacatagtcgggatatgcgacaccgtg
aagagagtaaatgcaagcttctgtcaagggctacctaaaccgggggagatagccttcatt
acgcagagcggagcactgggaatagcgctggtagggtggacgaagctgaagggcataggg
ctctccgacctggtcagcataggcaacaaagccgatgttgatgagacagaccttgtagag
tttttcggggaagaccagtacaccaaggttataaccgcatacctggaaggggtgagcgac
gggagaaggttcctcgaggctgcacgccgcgtagcgaggcggaagccaataatcgtactc
aaggcgggtagaggtgtaagaaccataggcgccatcaaatcgcacacgggttcgcttgca
gggagcttcgcagcttatgaggcggcgttcaagcagtcgggtatcctgcttgcgcgtagc
ttcgtagagctcttcgactgggcgactgctttcgcgaagacgcacattccgagaggggag
aacgtcgttgtgcttacgaatggcggaggagcgggtataatggcgaccgacgcgttggaa
gactatggaatcaggctgatggacataccccaggacctagccgagaagctgaggaagcac
atgccgcccttcgggagcgtcttcaaccccgtagacctcacgggcatggcagacgcggaa
cagtactacggcgcgctcaaagacctgttgatgcatgactctgtggacgccgtgctggta
ctctactgccacacagccataacgaacccacaggagatagcggaagcgctactaagggct
gtccgggagacggaaagcaagaagacagttcttgcgtcgttcataggcggcgaagaggta
aacgaggcgtgcgggaagcttaccgaaaacggtattccgtgctacgagtcgcccgagaag
gcggcgtccagcctgggcgccatctacaggtacaaacacatgctcgaaaaactcgacagg
aggaccgaggtagccgtaagcgttgacgtcgaagctgcgcgccacgtggttaggagcgcc
ttgaaggaggggagaacgacgctaacgccctcggaggccgcggcgctggtcgggtactat
gggatcccggtcttagcgaagaagatcgctaaaagccccgaggaagcagtgaggatagcg
cgagagatcgggtaccccgtggttctcgaggtggagtcccccgacatcctccataaaagc
gacatcggcggtatactggtagggcttcaaagcgacgccgaggtagccgaggggtacagc
aagatactcgacaatgtatccaagaaagctcccagcgccagggttaacggtatcatcgtt
aggaagatggcggagaaaggcaaggagatagcactgggcgtgcacagagaccccattttc
ggaccgctggtaatggtaggctccggaggagtcctcgtggagctctacagggatgtgagc
ttccgcgtagctcccctgagcctggaggacgcctacgaaatgctcgaagagacgaagatc
tacaaggtgctcaaaggatacagaggagaacccccctccgactacgaaaaggttgtcgac
gttctgataaggctgtcaaaactcgcctgcgacgtagaggagatcgaggacatagacatc
aacccgttcttcgtatacgagagagggaaaggagggattgcggtagacgtcaaagtaacc
ctcgtacagcgctag

DBGET integrated database retrieval system