KEGG   Thermofilum pendens: Tpen_0752Help
Entry
Tpen_0752         CDS       T00446                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tpe  Thermofilum pendens
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tpen_0752
Enzymes [BR:tpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tpen_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
703548..704480
Genome map
AA seq 310 aa AA seqDB search
MGKPRFAVSGNANLDVYLVVERIPGPDEAVEAVETRSYVGGAATNVAVALARLGVYARFL
GFVGGDDEGARVLKELGGNGVDTGYVQMSSLPTGRVIVLLDRQGRRAMVALRGANTELKP
GCFNAESVLGGVDHLHLSSTHPGYTAWLLQEAKRLGLSTSWDPGMAVVSRSPQEVLKAAR
SADVLFLNEREYEALRGGLAELGETLVVVKRGEEGSEAPRLGVKVKAFRVSPVDTTGAGD
TFDASFLVAWKLGLSVEDCLLLGNAAGALKVTRMGAHSSPTLRELYDFLSSRVESGEALP
RLAGLFRDLA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacccaggttcgccgtttcggggaatgccaacctcgacgtgtaccttgtagtg
gaacgcataccggggccggacgaggctgttgaagctgttgagacgaggtcctacgttggg
ggcgcggctactaacgtcgcggtagcgcttgcaaggctcggtgtctacgcgcgttttctg
ggctttgtcggcggggatgacgagggtgcaagggttcttaaggagctcggaggcaacggt
gtcgacaccggttacgtgcagatgtctagcctgcctactgggcgcgtaattgtactgctc
gacaggcaggggaggagggctatggtagccctcaggggtgcgaacaccgagctgaagccg
ggttgcttcaacgccgaaagcgttctcggaggggtagaccaccttcacctgagtagcacg
caccccggctacaccgcgtggctactccaggaggctaagaggctcgggctctccaccagc
tgggatcccgggatggcggtcgtgtcccggtcgccgcaagaagtgctcaaagccgctaga
agcgccgacgtactcttcctgaacgagcgcgagtacgaagcccttaggggcggcctcgcc
gagctcggggagactctcgtggtggtgaagaggggagaagaggggtccgaggctccccgg
ctcggagtcaaggtgaaagccttcagggtttcacccgtggacactacgggtgccggcgac
accttcgacgcctccttcctagtagcgtggaagctgggcctcagcgttgaagactgcttg
ctcctgggcaacgcggcaggggctctcaaagtcacgcgcatgggcgcgcactcctctccc
actctgagagagctctacgacttcctttcgtcgagggtagagtctggggaagcactacct
aggctagcggggctcttccgggacctcgcctag

DBGET integrated database retrieval system