KEGG   Thermofilum pendens: Tpen_0890Help
Entry
Tpen_0890         CDS       T00446                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpe  Thermofilum pendens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpen_0890
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpen_0890
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tpen_0890
Enzymes [BR:tpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tpen_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
837532..838914
Genome map
AA seq 460 aa AA seqDB search
MSKKYFLDEEELPREWYNILPDLPEPLPPPLNPATGKPVSPEDLEPIFPKELIRQEVSQE
RFIPIPEEVLEVYRIWRPTPLIRATRLEKALRTPARIYYKYEGVSPPGSHKPNTAVAQAY
YNAREGVARLTTETGAGQWGSALSFATMLFGLKLTVYMVRVSYQQKPYRAILMQTWGAEV
VPSPSNRTKAGRAFLEKDPEHPGSLGIAISEALEDAIEHEDTKYSLGSVLNHVLLHQTII
GLEAIKQMQALDEFPDIVIGCVGGGSNFAGISYPFYYLVRSGKAPKKTRFLAVEPASCPS
MTKGEYMYDFGDTARLTPLLKMYTLGHDFVPPPIHAGGLRYHGAAPTLSLLKKAGIFESV
AYNQVEVFEAARLFARTEGIVPAPESAHAIKAVIDEALEAKRKGEEKVILFNLSGHGLLD
LAAYREFLEGRLPAHEYPAEAIQKSIAKIKEYLLARGIQP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaatacttcctagacgaagaggagctaccgagggagtggtacaatatacta
ccagacctgcccgagcccctaccgccaccgctgaaccccgcaaccgggaagcccgtctcg
ccagaagaccttgaacccatattccccaaggagcttatcaggcaggaggtatcgcaggag
aggtttatcccgatacccgaagaggtactcgaggtgtacaggatatggaggcctaccccc
ctcatcagggccaccaggctggagaaagccctcaggacccctgcgaggatctactacaag
tacgaaggggtatcgcccccagggagccataagccgaacacggctgtcgcgcaggcgtac
tacaacgcgcgcgaaggcgtggcgcgcctcacgacggagaccggggctgggcagtgggga
agcgctttatcgttcgcgaccatgctgttcgggctcaagcttacggtgtacatggtgagg
gtgagctaccagcagaagccctacagggctatactgatgcagacttggggcgccgaggtc
gtcccgagccccagtaacaggactaaggcgggcagggctttcctcgagaaggaccccgag
caccccggctctctcggtatagcgatcagcgaggcgctggaagacgcaatagagcacgag
gacacgaagtacagcctgggtagcgtgctaaaccacgtgctgctccaccagacgatcata
gggctcgaagccatcaagcagatgcaggcgctcgacgagttccccgacatagtgataggc
tgtgtgggcggtgggagcaacttcgcgggaatatcgtaccccttctactacctggtgcgt
agcgggaaggcaccgaagaagacgaggttcctcgccgtggagcctgcgtcctgcccctcc
atgaccaagggagagtacatgtacgacttcggcgacacggcgaggcttacaccgctccta
aagatgtacacgctgggacacgacttcgtgccaccgccgattcacgccggcggactacgt
taccacggcgcggctccaaccctaagccttctcaaaaaagcggggatcttcgagagcgtt
gcctacaaccaggtggaagtcttcgaggcggcgaggctcttcgcccggacggagggcata
gtgcctgctcctgagagcgcccacgccataaaggcggtcatcgacgaggccctagaggct
aagaggaagggcgaggaaaaggtcatactcttcaacctgagcgggcacgggctcttggat
ctcgccgcctacagggagttcctcgagggacgattaccggcgcacgagtaccccgccgag
gcgatacagaagtccatcgcgaagatcaaggagtacctactcgcgcggggcatacagccc
tag

DBGET integrated database retrieval system