KEGG   Thermofilum pendens: Tpen_0890Help
Entry
Tpen_0890         CDS       T00446                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tpe  Thermofilum pendens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpen_0890
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpen_0890
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tpen_0890
Enzymes [BR:tpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tpen_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
837532..838914
Genome map
AA seq 460 aa AA seqDB search
MSKKYFLDEEELPREWYNILPDLPEPLPPPLNPATGKPVSPEDLEPIFPKELIRQEVSQE
RFIPIPEEVLEVYRIWRPTPLIRATRLEKALRTPARIYYKYEGVSPPGSHKPNTAVAQAY
YNAREGVARLTTETGAGQWGSALSFATMLFGLKLTVYMVRVSYQQKPYRAILMQTWGAEV
VPSPSNRTKAGRAFLEKDPEHPGSLGIAISEALEDAIEHEDTKYSLGSVLNHVLLHQTII
GLEAIKQMQALDEFPDIVIGCVGGGSNFAGISYPFYYLVRSGKAPKKTRFLAVEPASCPS
MTKGEYMYDFGDTARLTPLLKMYTLGHDFVPPPIHAGGLRYHGAAPTLSLLKKAGIFESV
AYNQVEVFEAARLFARTEGIVPAPESAHAIKAVIDEALEAKRKGEEKVILFNLSGHGLLD
LAAYREFLEGRLPAHEYPAEAIQKSIAKIKEYLLARGIQP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaatacttcctagacgaagaggagctaccgagggagtggtacaatatacta
ccagacctgcccgagcccctaccgccaccgctgaaccccgcaaccgggaagcccgtctcg
ccagaagaccttgaacccatattccccaaggagcttatcaggcaggaggtatcgcaggag
aggtttatcccgatacccgaagaggtactcgaggtgtacaggatatggaggcctaccccc
ctcatcagggccaccaggctggagaaagccctcaggacccctgcgaggatctactacaag
tacgaaggggtatcgcccccagggagccataagccgaacacggctgtcgcgcaggcgtac
tacaacgcgcgcgaaggcgtggcgcgcctcacgacggagaccggggctgggcagtgggga
agcgctttatcgttcgcgaccatgctgttcgggctcaagcttacggtgtacatggtgagg
gtgagctaccagcagaagccctacagggctatactgatgcagacttggggcgccgaggtc
gtcccgagccccagtaacaggactaaggcgggcagggctttcctcgagaaggaccccgag
caccccggctctctcggtatagcgatcagcgaggcgctggaagacgcaatagagcacgag
gacacgaagtacagcctgggtagcgtgctaaaccacgtgctgctccaccagacgatcata
gggctcgaagccatcaagcagatgcaggcgctcgacgagttccccgacatagtgataggc
tgtgtgggcggtgggagcaacttcgcgggaatatcgtaccccttctactacctggtgcgt
agcgggaaggcaccgaagaagacgaggttcctcgccgtggagcctgcgtcctgcccctcc
atgaccaagggagagtacatgtacgacttcggcgacacggcgaggcttacaccgctccta
aagatgtacacgctgggacacgacttcgtgccaccgccgattcacgccggcggactacgt
taccacggcgcggctccaaccctaagccttctcaaaaaagcggggatcttcgagagcgtt
gcctacaaccaggtggaagtcttcgaggcggcgaggctcttcgcccggacggagggcata
gtgcctgctcctgagagcgcccacgccataaaggcggtcatcgacgaggccctagaggct
aagaggaagggcgaggaaaaggtcatactcttcaacctgagcgggcacgggctcttggat
ctcgccgcctacagggagttcctcgagggacgattaccggcgcacgagtaccccgccgag
gcgatacagaagtccatcgcgaagatcaaggagtacctactcgcgcggggcatacagccc
tag

DBGET integrated database retrieval system