KEGG   Thermofilum pendens: Tpen_0893Help
Entry
Tpen_0893         CDS       T00446                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpe  Thermofilum pendens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpen_0893
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0893
   00620 Pyruvate metabolism
    Tpen_0893
   00640 Propanoate metabolism
    Tpen_0893
  Energy metabolism
   00680 Methane metabolism
    Tpen_0893
Enzymes [BR:tpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tpen_0893
Lipid biosynthesis proteins [BR:tpe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tpen_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
842012..843928
Genome map
AA seq 638 aa AA seqDB search
MGVLPVEERRVLTAKLDEMRRKALEDPESFWDEHARALEWYKIWDKVLDDGEKPFYRWFV
GGRINASYNALDRHVKTWRKNKVALIWEGEDGSVKKYSYRDLYVEVNRVAALLKNFGVKK
GDRVALYLPMIPELPIFMLAAARIGAPFTVIFSGFSSDSLAKRLNDSGAKLLVTADGFWR
RGRVVRLKDIADKSLEQALSVESVLVVRHAGVDVAMQEGRDYWYHEALEGIGRNTYVEPE
RLDSNHPLFILYTSGTTGTPKGIYHSTGGYLVWVYWTLKWAFNPNDEDIWWCTADIGWIT
GHSYVVFGPLLHGLTTLMYEGAPDYPAPDRWWSIIERHGVTVFYTSPTAIRMFMRYGSHW
VEKHDLSSLRILGSVGEPINPEAWEWYFKVVGKGRCPIIDTWWQTETGGFMISPAAGIEL
VPLKPGSATLPLPGVDADVVDDNGNPAKPGVQGYLVIKRPWPGMLLGVWGDPERYVKTYW
GRFDGYYFPGDYAMKDEDGYFWILGRADEVLKVAAHRIGTMELESALVEHPAVSEAAVVG
KPDPVKGEVPVAFVVLKEGFSPSVKLEEELSNHVAEVIGPIARPAAIIFVKKLPKTRSGK
IMRRVLKALVRGEASLGDLSTIEDPSAVDEVKAALRIA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtactcccggtcgaggagaggagggttttaacggcgaagctagacgagatgcgg
agaaaagcgcttgaggatcccgagtccttctgggacgagcatgcaagggcgctggagtgg
tacaagatctgggataaggtcctagacgatggggagaagcctttctacaggtggttcgtg
gggggaaggatcaatgctagctacaacgccctggacaggcacgtgaagacctggaggaag
aacaaggtagcgctgatatgggagggggaggacggctcggtgaagaagtactcgtacagg
gacctctacgtagaggtaaacagggtagcggcccttctaaagaacttcggggtcaagaag
ggggatagggtcgccctctaccttcccatgatcccggagctcccgatcttcatgctcgct
gccgccaggataggggcccccttcacggtgatattctcgggattctcgagcgactctctc
gccaagaggctcaacgactctggggcgaagctcttggtaaccgccgacggcttctggagg
agggggagggtcgtgaggctgaaggatatagcggacaagtccctagagcaggccctgagc
gtggagagtgtcctcgtagtgaggcacgcgggggtagacgtcgcgatgcaggagggccgc
gactactggtaccacgaggccctggagggtataggcaggaacacctacgtagagccggag
aggctcgactccaaccacccgctcttcatactctacacctccggaactacgggtacgcct
aaaggcatctaccacagcacgggtggctaccttgtgtgggtatactggacgctcaagtgg
gctttcaacccgaacgacgaggacatctggtggtgcacggcagacatagggtggattacg
gggcacagctacgtcgtctttggcccgctcctgcacggcttaaccacgcttatgtacgag
ggtgccccggactacccggccccggacaggtggtggagcatcatcgagaggcacggggtc
accgtcttctacacgtctccaactgccattaggatgttcatgcgctacggctcgcactgg
gtcgagaagcacgacctgtcgagcctcaggatactcgggagcgtcggggagcctataaac
cccgaagcgtgggaatggtacttcaaggtagtcgggaagggcaggtgcccgataatcgac
acctggtggcagacggagacgggcggcttcatgatatcgcctgcggcgggcatagagctc
gtaccactcaagccgggctcggctaccctgcccctaccgggcgtagacgccgacgtagtg
gacgacaacgggaaccccgcgaagccaggcgtgcagggctacctggtgatcaagcgcccg
tggccgggcatgttgctaggcgtctggggcgacccggagaggtacgttaaaacgtactgg
ggcaggttcgacgggtactacttccccggggactacgccatgaaggacgaggacggctac
ttctggatcctcggcagggccgacgaggtcttaaaggtagccgcccacaggataggaacc
atggagcttgaaagcgcactcgtcgagcacccggccgtaagcgaagccgcggtcgtcggg
aaaccggaccccgtaaagggagaggtacctgtcgccttcgtcgtactcaaggaaggcttc
tctccgagcgtgaagctcgaggaagagctttccaaccacgtcgcggaggtcataggtccg
atagcgaggcctgccgcgataatcttcgtcaagaagcttccgaagacgaggagcggcaag
ataatgaggagggttttgaaggcgctcgtcagaggggaggcgagcctcggggacctctcc
acgatagaagacccatcggccgtcgacgaagtgaaggcggctctgaggatagcctag

DBGET integrated database retrieval system