KEGG   Thermofilum pendens: Tpen_0893Help
Entry
Tpen_0893         CDS       T00446                                 

Definition
(RefSeq) acetyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tpe  Thermofilum pendens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpen_0893
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0893
   00620 Pyruvate metabolism
    Tpen_0893
   00640 Propanoate metabolism
    Tpen_0893
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Tpen_0893
   00680 Methane metabolism
    Tpen_0893
Enzymes [BR:tpe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tpen_0893
Lipid biosynthesis proteins [BR:tpe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tpen_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
842012..843928
Genome map
AA seq 638 aa AA seqDB search
MGVLPVEERRVLTAKLDEMRRKALEDPESFWDEHARALEWYKIWDKVLDDGEKPFYRWFV
GGRINASYNALDRHVKTWRKNKVALIWEGEDGSVKKYSYRDLYVEVNRVAALLKNFGVKK
GDRVALYLPMIPELPIFMLAAARIGAPFTVIFSGFSSDSLAKRLNDSGAKLLVTADGFWR
RGRVVRLKDIADKSLEQALSVESVLVVRHAGVDVAMQEGRDYWYHEALEGIGRNTYVEPE
RLDSNHPLFILYTSGTTGTPKGIYHSTGGYLVWVYWTLKWAFNPNDEDIWWCTADIGWIT
GHSYVVFGPLLHGLTTLMYEGAPDYPAPDRWWSIIERHGVTVFYTSPTAIRMFMRYGSHW
VEKHDLSSLRILGSVGEPINPEAWEWYFKVVGKGRCPIIDTWWQTETGGFMISPAAGIEL
VPLKPGSATLPLPGVDADVVDDNGNPAKPGVQGYLVIKRPWPGMLLGVWGDPERYVKTYW
GRFDGYYFPGDYAMKDEDGYFWILGRADEVLKVAAHRIGTMELESALVEHPAVSEAAVVG
KPDPVKGEVPVAFVVLKEGFSPSVKLEEELSNHVAEVIGPIARPAAIIFVKKLPKTRSGK
IMRRVLKALVRGEASLGDLSTIEDPSAVDEVKAALRIA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtactcccggtcgaggagaggagggttttaacggcgaagctagacgagatgcgg
agaaaagcgcttgaggatcccgagtccttctgggacgagcatgcaagggcgctggagtgg
tacaagatctgggataaggtcctagacgatggggagaagcctttctacaggtggttcgtg
gggggaaggatcaatgctagctacaacgccctggacaggcacgtgaagacctggaggaag
aacaaggtagcgctgatatgggagggggaggacggctcggtgaagaagtactcgtacagg
gacctctacgtagaggtaaacagggtagcggcccttctaaagaacttcggggtcaagaag
ggggatagggtcgccctctaccttcccatgatcccggagctcccgatcttcatgctcgct
gccgccaggataggggcccccttcacggtgatattctcgggattctcgagcgactctctc
gccaagaggctcaacgactctggggcgaagctcttggtaaccgccgacggcttctggagg
agggggagggtcgtgaggctgaaggatatagcggacaagtccctagagcaggccctgagc
gtggagagtgtcctcgtagtgaggcacgcgggggtagacgtcgcgatgcaggagggccgc
gactactggtaccacgaggccctggagggtataggcaggaacacctacgtagagccggag
aggctcgactccaaccacccgctcttcatactctacacctccggaactacgggtacgcct
aaaggcatctaccacagcacgggtggctaccttgtgtgggtatactggacgctcaagtgg
gctttcaacccgaacgacgaggacatctggtggtgcacggcagacatagggtggattacg
gggcacagctacgtcgtctttggcccgctcctgcacggcttaaccacgcttatgtacgag
ggtgccccggactacccggccccggacaggtggtggagcatcatcgagaggcacggggtc
accgtcttctacacgtctccaactgccattaggatgttcatgcgctacggctcgcactgg
gtcgagaagcacgacctgtcgagcctcaggatactcgggagcgtcggggagcctataaac
cccgaagcgtgggaatggtacttcaaggtagtcgggaagggcaggtgcccgataatcgac
acctggtggcagacggagacgggcggcttcatgatatcgcctgcggcgggcatagagctc
gtaccactcaagccgggctcggctaccctgcccctaccgggcgtagacgccgacgtagtg
gacgacaacgggaaccccgcgaagccaggcgtgcagggctacctggtgatcaagcgcccg
tggccgggcatgttgctaggcgtctggggcgacccggagaggtacgttaaaacgtactgg
ggcaggttcgacgggtactacttccccggggactacgccatgaaggacgaggacggctac
ttctggatcctcggcagggccgacgaggtcttaaaggtagccgcccacaggataggaacc
atggagcttgaaagcgcactcgtcgagcacccggccgtaagcgaagccgcggtcgtcggg
aaaccggaccccgtaaagggagaggtacctgtcgccttcgtcgtactcaaggaaggcttc
tctccgagcgtgaagctcgaggaagagctttccaaccacgtcgcggaggtcataggtccg
atagcgaggcctgccgcgataatcttcgtcaagaagcttccgaagacgaggagcggcaag
ataatgaggagggttttgaaggcgctcgtcagaggggaggcgagcctcggggacctctcc
acgatagaagacccatcggccgtcgacgaagtgaaggcggctctgaggatagcctag

DBGET integrated database retrieval system