KEGG   Thermofilum pendens: Tpen_0901Help
Entry
Tpen_0901         CDS       T00446                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tpe  Thermofilum pendens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpen_0901
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_0901
   00052 Galactose metabolism
    Tpen_0901
   00500 Starch and sucrose metabolism
    Tpen_0901
   00520 Amino sugar and nucleotide sugar metabolism
    Tpen_0901
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tpen_0901
   00524 Butirosin and neomycin biosynthesis
    Tpen_0901
Enzymes [BR:tpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tpen_0901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
849510..850469
Genome map
AA seq 319 aa AA seqDB search
MKYAVAVDIGATQTRVALGNDEGEILELHVFKTSSFPGPDEYLRHIAGLALSLEKKHGVE
VEGIGVGSPGPLDMKKGEVLKSVNMPFDRLPVVSALKSLTGKKVAFANDAVTAAVGEKYW
GAGRGLENLVYVTISTGIGAGIYVDGELLLGKHGNAHEVGHVVVDSGEEMTCGCGKKGHW
EAYCSGSGIPRYAKFLAARNPELWEKSPLKSREPLTAKDVFDAFREGDALARLVMERVRK
FNAYGFAVLVNVYDPEIITVGGSVALNNPDVLLAGLKEEVEKYALNVVPEIRLTPLGDKI
GVLGALALGLGLEKKVPLV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacgccgtagcagtggatataggcgctacgcagacccgcgtagccctcgggaac
gacgagggggagattctagagctccacgtcttcaagacgtcttccttccccgggcccgac
gagtacctgcgccacatagccggcttggctttaagcctagagaaaaagcacggcgtggaa
gtagagggtataggggtgggatctccgggccccctcgacatgaagaagggggaggtactc
aaatccgtgaacatgcctttcgataggctacccgtagtctccgccctgaagtccctgacg
gggaagaaagtggcttttgcgaacgacgcggtgacggcggcggttggggagaagtactgg
ggcgcggggagggggttggagaacctggtctacgtcactataagcacggggataggcgct
gggatctacgtcgacggggagctcctcctcggcaagcacgggaacgcccacgaagtaggc
cacgtcgtcgtcgactcgggggaagagatgacgtgtggttgcggcaagaagggacactgg
gaggcctactgctccgggtccggcatacccaggtacgcgaagttcctggcggccagaaac
cccgagctctgggagaagagccccctcaagtccagggagcccctcacggctaaagacgta
ttcgacgcgttccgggagggcgacgcgctggcaaggcttgttatggagagagttaggaag
ttcaacgcgtacgggttcgcggtgctcgtcaacgtgtacgaccccgagataatcacagtg
ggtggatcggtcgccctgaacaacccggacgtcctgctcgccgggctgaaggaggaggtc
gagaagtacgctttaaacgtggttcctgagatcaggctgaccccgctcggagacaagata
ggggttctgggagcgctggcgctgggcctcggcctcgaaaagaaggtccccctcgtttaa

DBGET integrated database retrieval system