KEGG   Thermofilum pendens: Tpen_1128Help
Entry
Tpen_1128         CDS       T00446                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tpe  Thermofilum pendens
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tpe00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1066268..1067839)
Genome map
AA seq 523 aa AA seqDB search
MSKLVLVIDQGTTGTRAAIFDPEGRPVPGGWSYREHTQIYPRPGWVEHNPLEIWEKTLEC
IRDAVRRSKVDPGEIAAIGVTNQRETVVVWDVRTGNPLYNAIVWQDRRTAPITDKLKEER
LEEIREKTGLIPDPYFSGSKIQWLLENVEGLREKVARREAVFGTIDSWIIWNLTRGSREV
LTPEKGGAHVTDYSNASRTMLFNIKRLEWDPELLEAMGGIPEDSLPTPRPSSDPEIYGYT
GPELNGIFNGKSIAVAGDAGDQQAALFGQAGFTPGDVKCTYGTGNFILMNTGGEIRYSRS
GLLTTVFYSLSKGRATYALEGSIFITGAAIQWLRDGLKLIEVSPEIDPLAESADDTGGLY
FVPAFTGLGAPYWDPYARGLIIGITRGTTRKHLARAVLESIAYLTRDVVEAMQADAGYAV
RILKADGGAARSDFLLQFQADILGVDVVRPLVRETTALGAAYLAGLAVGVWSSLDEVGRL
WREEKRFTPQMSREKREQLYAGWKAAVKRALGWAKEVPWAYGY
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagctagtcttggtaatagatcagggtactactggaacccgagcggctattttc
gacccggaaggtagacccgtgcctggcgggtggtcttacagggagcacacgcagatctac
cccaggcctgggtgggttgagcacaaccccctagagatctgggagaaaacgctagagtgc
ataagggacgccgtgaggaggtccaaggtggacccgggcgagatagccgcgataggagtg
actaaccagagggagactgttgtcgtctgggacgtccgcaccgggaaccctctctacaac
gcgatagtgtggcaggataggcgtacagccccgataactgataaattgaaggaggagcgg
ctggaggagatacgcgagaagaccgggcttatcccggacccctacttctccgggagcaag
atacagtggttgctcgagaacgtggaggggcttcgcgaaaaggtagctaggcgggaggct
gtcttcggcacgatagactcctggatcatatggaaccttacgcgcggatccagggaggtg
ttaacccctgagaaaggcggcgcccatgtaaccgactactcaaacgccagtaggaccatg
ttgttcaacataaagaggcttgagtgggacccagagctactggaggctatgggcgggata
ccggaggactctcttccaacgccgaggccctcctcggacccggagatatacgggtacacc
ggcccggaacttaacggtatattcaacggtaagagcatagccgtcgccggggacgctgga
gaccagcaggcagcgctattcgggcaggcggggttcacgccgggagacgttaaatgcacg
tatggcaccgggaactttatactcatgaatacaggcggggagatacgctactcgaggagc
gggcttctaaccacggtgttctactctctatcaaagggtagagcgacctacgcgctcgaa
ggaagcatattcataactggggctgctatccagtggctaagagacgggctgaaactgata
gaagtgtccccggagatcgaccccctcgcggagtcggcggacgatacgggcgggctgtac
ttcgtcccggcgttcacggggctcggagccccctactgggatccctacgcgagggggctc
atcatagggattacccgcggaaccacgagaaagcatttagcgcgggcagtactcgaaagc
atagcctacctcacgagggacgttgtggaagccatgcaggcagatgctggctacgctgtg
aggattcttaaagcggacgggggcgctgcaaggagcgacttcctcctacagttccaggca
gacattctgggagtagacgttgtaagacccctcgtacgggagacgaccgctctcggggca
gcctacctggcgggtttagctgtaggcgtttggagcagcctggacgaggtggggaggctc
tggagggaggagaagaggtttacgccccagatgagccgcgagaaaagggaacagctctac
gccggctggaaggccgccgtcaagcgggcgctcggctgggccaaggaggttccctgggcg
tacggctactaa

DBGET integrated database retrieval system