KEGG   Thermofilum pendens: Tpen_1373Help
Entry
Tpen_1373         CDS       T00446                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tpe  Thermofilum pendens
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tpen_1373
Enzymes [BR:tpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tpen_1373
Exosome [BR:tpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tpen_1373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1328056..1329495)
Genome map
AA seq 479 aa AA seqDB search
MYGVIDVGTTGVKLAVFDGELKSIHYERVELGYEPAGSGRVEQSSAEMSRVVRGFARKAR
SLGARRIGLSTYRASVVAWSKSGEPLTNIVTWIDGRGREVVERLPVWVKLLEALSPSLAK
VLRPDTPAVLMKWLYDNVPGLREKVERGDAYLWTLDSYLVYLLTGRYASDATSSALTGLV
HPRDLEPIGAVFGILSLPEAAPEIVDSVHEFGEFEGADVAVSIADQQAASVYHGLLEPGR
VSGVHGTGSFVEESTPKLVVPGEGLVPVVIASLDGRRFYGAEGFLRASGLVVEWLRSAGF
FSSYEEMESLASKAKPRAIVVPSFRGLRTPDAPLLKGMILGLDPSTTKADVVAGLAWGVA
LYVAYLLGKLSKYCGSPREPLWSGGGYSRSNAFLQALADATGLKVARPRDVESSIRGVLK
LLLYSEGKASLDDLKEPPEVDAYFEPRAGSEAKTLVGELEELLEVVARWEENAFLSGRF
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgtacggggttatagacgtggggactacgggcgtaaagcttgctgtcttcgacggggag
ctgaagagtatacactacgagagggtggagctgggctacgagcctgcgggcagcgggaga
gtcgagcagagcagcgccgagatgtcgagagtcgtgagggggttcgccaggaaggctagg
tccctcggggccaggaggatagggctctcgacgtacagggcgtcggtcgtagcgtggagc
aagagcggggagcccctcacgaacatagtgacctggatagacgggcgggggcgcgaggtc
gtcgagaggctacccgtctgggtcaagctcctcgaagccctaagcccctcgctcgccaag
gtactgcgcccagacacgccggcagtgctcatgaagtggctgtacgacaacgtcccggga
ctccgcgagaaggtcgaaaggggcgacgcgtacctctggaccctcgactcctaccttgta
tacctgctcaccggcaggtacgcctcggacgctacgagctccgcgctcacagggctggta
caccccagggacctggagcccataggcgccgtgttcgggatcctctcgctccccgaggcg
gcccccgagatcgtcgactcggtgcacgagttcggcgagttcgaaggcgccgacgtcgcc
gtctccatagcggaccagcaggcggcatccgtttaccacggcctactggagcccgggagg
gtgagcggggtccacggaaccggtagcttcgtcgaggagtcaacgccgaagctcgtcgtg
cccggggaggggctggtgcccgttgtcatagctagtctggacggcaggaggttctacggc
gccgagggcttcctgagggcctcagggctcgtggtggagtggctcaggagcgccggcttc
ttctcctcctacgaggagatggagagcctagcctccaaggcgaagccccgggcaatagtc
gtcccctccttccgcgggctcaggaccccggacgccccgctcctcaaggggatgatactc
gggctcgacccctccacgaccaaggcggacgtagtagcagggctcgcctggggggtagcg
ctctacgttgcctacctgctcgggaagctctcgaagtactgcgggagcccccgcgaaccc
ctctggtcgggcggcggctacagcaggtcgaacgcctttctccaggcgctggcggacgcc
acggggctgaaggtggcgaggcccagggacgtcgagtcgagcataaggggcgtgctgaag
ctactcctatactcggagggcaaggcgtcgctggacgacctcaaggagccgcccgaggtc
gacgcgtacttcgagccgcgcgcgggctccgaggcgaagactttagtaggcgagctggag
gagctactcgaggtggttgcgaggtgggaggagaacgcgttcctaagcgggaggttctag

DBGET integrated database retrieval system