KEGG   Thermofilum pendens: Tpen_1413Help
Entry
Tpen_1413         CDS       T00446                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tpe  Thermofilum pendens
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpen_1413
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tpen_1413
Enzymes [BR:tpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Tpen_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1365988..1367865
Genome map
AA seq 625 aa AA seqDB search
MALYGYAGRLLEVDLSRGKHRVVELEEDVAFNFIGGRGLAAYLLWRELGDRWEEVDPLGP
ENMLLVLTGPLTGYYPGVKLCISGKSPQSNGVVGSVVSSEVAVELRAAGYDGIVVKGASK
DPVYLYVEGENVEIRSAEHLWGLGGTETYRRLSRELWGDLKRRLLAREGLTKEPSFIYIG
PAGENRVRTAAVMAKLSHAAGYGGYGAVMGSKMLKAIAVKGFGPMPRAKHPDWVKLLIRE
AWSALNRNVLWKHWGTSSGGYEVASLTSSEPVRNWQEEWHDSRSMGVQNYEAHWVKRYWG
DYGCPQTCMKISRLRSGKFSGATTDGPDYELQAYLGPNLGVFEPRANVYLSSLADELGLC
GIQTGNVLGFAAELYEKGVLTREDLGFELKWGDAEAFARLMSMIARREGIGDCLAEGTAR
AALKLGKLKGVDLSKYAVHVKGVGVGAHGARSGKDFPQAFTYAVGVQGGDHTSPPRLPVD
RQWGEFTSAFEDSAVICSFNVHGDLPFQFLRAITGWDITRETWMRVHGRRIITLQRVLLL
LGGPDLYWDPRRDDDNPPRFYEPLPSGPFKGRSVSREEVESQKREYFGYLGWDSLGIPTE
ETLRELGLDYLKPAVERIRKRLGAG
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
gtggctctctacggctacgcggggaggctcctcgaggtggacctctcgcgggggaagcac
agggtcgtagagctggaggaggacgtagcgttcaacttcataggcggtagggggctcgcg
gcctacctcctctggagggagctgggggacaggtgggaggaggtagaccccctgggcccc
gaaaacatgttgctagtcctaacggggcccctcacgggctactacccgggcgttaagctc
tgcatctcgggtaagtccccccagtccaacggcgttgtgggctccgtcgtctccagcgag
gtcgcggtagagctcagggcggccggctacgacgggatcgtcgtgaagggtgcgtccaag
gaccccgtctacctctacgtggagggggaaaacgtcgagataaggtccgcggagcacctc
tgggggctcggggggacggagacctacaggaggctctcccgggagctctggggagacctc
aagcggaggttgctggcgcgcgaggggctcaccaaggagccgtcgttcatctacataggg
cccgccggggagaacagggtgaggactgccgccgtgatggcgaagctgtcgcacgccgcc
ggctacgggggctacggggctgtcatggggtctaagatgctgaaagccatagcggtgaag
ggcttcggcccaatgccgcgcgcgaagcacccggactgggtcaagctcctcatacgcgag
gcttggagcgccctcaacaggaacgtgctctggaagcactggggcacgagtagcgggggc
tacgaggtggcgtcgctgactagcagcgagcccgtgaggaactggcaggaggagtggcac
gactccaggagcatgggcgtgcagaactacgaggcccactgggtcaagaggtactggggc
gactacggctgcccgcagacctgcatgaagatctcgcgcctcagaagcgggaagttctcc
ggggcaaccacggacgggccggactacgagctacaagcatacctgggccccaacctaggc
gtgttcgagccaagggccaacgtatacctctcgagcctagccgacgagctcgggctctgc
ggcatacagaccgggaacgtgctgggcttcgccgccgagctgtacgagaagggggtgctg
acacgggaggacctgggcttcgagctcaagtggggcgacgccgaagccttcgccaggctc
atgtccatgatagcgcggagggaggggataggcgactgcctggcggagggcaccgcgagg
gcagccctaaagctcgggaagctgaagggcgtcgacctctcgaagtacgccgtacacgtg
aagggagtgggcgtcggcgcgcacggcgcccgcagcgggaaggacttcccgcaagccttc
acgtacgccgtgggtgtccagggaggagaccacaccagcccgccaaggctaccggtcgac
aggcagtggggagagttcacatcggcgttcgaggactcggcggtcatttgctccttcaac
gtccacggagacctccccttccagttcctgagggctatcacgggctgggacataacgcgg
gaaacctggatgagggtacacggcaggagaatcataacgctccagagggtgctcctactc
ctcggcggccccgacctctactgggacccgaggcgcgacgacgacaacccgccgagattc
tacgagccgctgcccagcggcccgttcaaggggaggagcgtgagcagggaggaggtggag
tcccagaagagggagtacttcggctacctgggctgggacagcctcgggataccgaccgag
gagacactcagagagctcgggctggactacctcaagcctgccgtcgagaggatcaggaag
aggctgggcgccggctaa

DBGET integrated database retrieval system