KEGG   Thermofilum pendens: Tpen_1465Help
Entry
Tpen_1465         CDS       T00446                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tpe  Thermofilum pendens
Pathway
tpe00051  Fructose and mannose metabolism
tpe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Tpen_1465
Enzymes [BR:tpe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Tpen_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ABL78862
JGI: Tpen1465
UniProt: A1S082
Position
1417177..1417824
Genome map
AA seq 215 aa AA seqDB search
MLYGDLRREVADAFRRLEELGLNWGYSGNISVRAGQGVYVVSPSGVLKSKLRPEDVLVVR
EDGSVVDGRGKPSVEFKTHLAVYRARRDVNAVVHAHPVYSGVLAALRVGLKPVLEELVLY
LGGPIEVAEYAPPGTEELARNVVKALGDRCAVLMANHGALACGSTLEEAIANLGYLERAA
KVAVYSRILGTPFELPEETVELERRLYLERRFGKA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctctacggggatttgagaagagaggttgcggacgccttcaggcggctcgaggagctc
gggctgaactgggggtacagcgggaatatcagcgtgcgcgcggggcagggcgtctacgtc
gtgtcgccgagcggcgtcttgaagtcgaagcttaggcccgaggacgtcctcgtcgtccgg
gaggacgggtcggtggtcgacggcagggggaagccctccgtggagtttaagacccacctg
gcggtctacagggcgaggcgggacgtgaacgcggttgtccacgcgcaccccgtctactcc
ggcgtcctggcggcgctgagggtggggcttaagcccgtgctggaagagctcgtactgtac
ctcggcgggccgatagaggtcgcggagtacgcccctcccggcaccgaggagctcgcgagg
aacgtcgttaaagctctgggcgacaggtgcgcggtcttaatggctaaccacggggcgctc
gcctgcggctccacgctcgaggaggctatagcaaacctggggtacctggagagggcggcg
aaggtggccgtgtactcccgcatcctcggcactccgttcgagctaccggaggagactgtg
gagctggagaggaggctctacctcgagaggaggttcgggaaggcctag

DBGET integrated database retrieval system