KEGG   Thermofilum pendens: Tpen_1511Help
Entry
Tpen_1511         CDS       T00446                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tpe  Thermofilum pendens
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tpen_1511
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tpen_1511
   00600 Sphingolipid metabolism
    Tpen_1511
Enzymes [BR:tpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tpen_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1459316..1460698)
Genome map
AA seq 460 aa AA seqDB search
MSRVPKIKISVIGAGSVAWSSKLVHDLLHTPSLYGSDVYFMDINEERLRILRGLAEKYKS
EVGAEYNFFYTTDRKEAVRDSDVVINTAMYGGHRYYELMREVSEKHGYYRGVNSVEWNMV
SDYHTIWGYYQWKLAMDIARDVEELAPGAWLIQMANPVFELTTLISRETRVKVVGLCHGH
LGYKEIAQTIGLDPARVGFEAIGFNHVIWLTKFTYDGEDAYPLIDRWVEEKAEQYWSQWR
MRQVNPFDIQMSPAAVDMYRRYGLFPVGDTVRGGTWKYHSSLKTKQYWYGPTGGPDSEIG
WALYTAHQEYWLATLAQAASDPRIPVSSLFPQTRTEESVVPLIESLMLDKPGEYQVNVLN
GNAIEGIPSNVAVEVPARVDARGIHPKTGLRLPRKILSLVMQPRLLRAEMAIAAFLEGGR
QFLIDWLMLDPRTRSEEQAEKVWEEILSLPGNEEMKRHYS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgcgtgccgaaaataaaaataagcgttataggcgcaggtagcgttgcgtggagc
tctaagctcgtacacgacctcctgcacacgccctccctgtacggtagcgacgtgtacttc
atggatataaacgaggagaggctacgcatcctcaggggtctcgcggagaagtacaagtcg
gaggtcggggcggagtacaacttcttctacacgacggacaggaaggaggctgtgagggac
tcggacgtcgtgataaacacggcgatgtacggtgggcacaggtactacgagcttatgcgc
gaggttagcgagaagcacggctactaccggggcgtgaacagcgttgagtggaacatggtg
agcgactaccacacgatatggggctactaccagtggaagctcgcgatggacatagcgagg
gacgtcgaggagctggcgccgggcgcctggctgatccagatggcgaaccccgtcttcgag
cttacaacactgatttcgcgggagacgagggtcaaggtcgtagggctgtgccacgggcac
ctgggctacaaggagatagcgcagacgatagggctcgacccggcgagggtgggcttcgag
gctataggcttcaaccacgtgatatggctgacgaagttcacctacgacggggaggacgcg
tacccgctcatagacaggtgggtagaggagaaggcggagcagtactggtcgcagtggagg
atgaggcaggtaaaccccttcgacatacagatgtcccctgcggctgtcgacatgtacagg
cgctacgggctcttcccggtaggcgacaccgtcagaggaggtacctggaagtaccactcg
agcctcaagacgaagcagtactggtacggccctacgggcggccccgacagcgagataggc
tgggctctctacaccgcgcaccaggagtactggctggcaacgctggcccaggcggcctcc
gacccgaggataccggtctcctccctcttcccgcagaccaggaccgaggagagtgtcgtc
ccgctaatcgagagcctcatgctcgacaagccgggcgagtaccaggtcaacgtgctcaac
ggcaacgcgatagaaggcatacccagcaacgtggcagtcgaggtgccggccagggtggac
gcccgcggtatacacccgaagaccgggctgaggctaccgaggaagatactctcgctcgtc
atgcagcccaggctgctccgcgcggagatggcgatagccgccttcctggagggcgggagg
cagttccttatagactggctcatgctggacccgaggacgaggagcgaggagcaggcagag
aaggtttgggaggagatactatcgctacccgggaacgaggagatgaagaggcactacagc
tag

DBGET integrated database retrieval system