KEGG   Thermofilum pendens: Tpen_1511Help
Entry
Tpen_1511         CDS       T00446                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tpe  Thermofilum pendens
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tpe00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tpe00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tpe00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1459316..1460698)
Genome map
AA seq 460 aa AA seqDB search
MSRVPKIKISVIGAGSVAWSSKLVHDLLHTPSLYGSDVYFMDINEERLRILRGLAEKYKS
EVGAEYNFFYTTDRKEAVRDSDVVINTAMYGGHRYYELMREVSEKHGYYRGVNSVEWNMV
SDYHTIWGYYQWKLAMDIARDVEELAPGAWLIQMANPVFELTTLISRETRVKVVGLCHGH
LGYKEIAQTIGLDPARVGFEAIGFNHVIWLTKFTYDGEDAYPLIDRWVEEKAEQYWSQWR
MRQVNPFDIQMSPAAVDMYRRYGLFPVGDTVRGGTWKYHSSLKTKQYWYGPTGGPDSEIG
WALYTAHQEYWLATLAQAASDPRIPVSSLFPQTRTEESVVPLIESLMLDKPGEYQVNVLN
GNAIEGIPSNVAVEVPARVDARGIHPKTGLRLPRKILSLVMQPRLLRAEMAIAAFLEGGR
QFLIDWLMLDPRTRSEEQAEKVWEEILSLPGNEEMKRHYS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcgcgtgccgaaaataaaaataagcgttataggcgcaggtagcgttgcgtggagc
tctaagctcgtacacgacctcctgcacacgccctccctgtacggtagcgacgtgtacttc
atggatataaacgaggagaggctacgcatcctcaggggtctcgcggagaagtacaagtcg
gaggtcggggcggagtacaacttcttctacacgacggacaggaaggaggctgtgagggac
tcggacgtcgtgataaacacggcgatgtacggtgggcacaggtactacgagcttatgcgc
gaggttagcgagaagcacggctactaccggggcgtgaacagcgttgagtggaacatggtg
agcgactaccacacgatatggggctactaccagtggaagctcgcgatggacatagcgagg
gacgtcgaggagctggcgccgggcgcctggctgatccagatggcgaaccccgtcttcgag
cttacaacactgatttcgcgggagacgagggtcaaggtcgtagggctgtgccacgggcac
ctgggctacaaggagatagcgcagacgatagggctcgacccggcgagggtgggcttcgag
gctataggcttcaaccacgtgatatggctgacgaagttcacctacgacggggaggacgcg
tacccgctcatagacaggtgggtagaggagaaggcggagcagtactggtcgcagtggagg
atgaggcaggtaaaccccttcgacatacagatgtcccctgcggctgtcgacatgtacagg
cgctacgggctcttcccggtaggcgacaccgtcagaggaggtacctggaagtaccactcg
agcctcaagacgaagcagtactggtacggccctacgggcggccccgacagcgagataggc
tgggctctctacaccgcgcaccaggagtactggctggcaacgctggcccaggcggcctcc
gacccgaggataccggtctcctccctcttcccgcagaccaggaccgaggagagtgtcgtc
ccgctaatcgagagcctcatgctcgacaagccgggcgagtaccaggtcaacgtgctcaac
ggcaacgcgatagaaggcatacccagcaacgtggcagtcgaggtgccggccagggtggac
gcccgcggtatacacccgaagaccgggctgaggctaccgaggaagatactctcgctcgtc
atgcagcccaggctgctccgcgcggagatggcgatagccgccttcctggagggcgggagg
cagttccttatagactggctcatgctggacccgaggacgaggagcgaggagcaggcagag
aaggtttgggaggagatactatcgctacccgggaacgaggagatgaagaggcactacagc
tag

DBGET integrated database retrieval system