KEGG   Thermofilum pendens: Tpen_1537Help
Entry
Tpen_1537         CDS       T00446                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpe  Thermofilum pendens
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tpen_1537
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tpen_1537
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tpen_1537
Enzymes [BR:tpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tpen_1537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1484901..1485878
Genome map
AA seq 325 aa AA seqDB search
MEEGDSSSSKLLALSTPLLKLTSLRKLLNLDGAAVYLKYEGYNPTGTHKDRAALAHVGEA
VLNGYDTVTVGTCGNYGVAVAYYARLAGLRAVIFVPKGYSNSRVPEMKRYGARVVEVEGP
YEDAVAVSVSSARANGWYDANPGSVNDHVSIEAYSLIAREIVRQLGDAPAVVAVPVGNGT
TLVGIYHGFYRLYRAGETTRIPRMVAASTSNANQLVYSWSRGSTEPLPVEVSEVRETPVN
EPLVAIRSLNAEEALRAIYASKGAAFGFSDSEMVEMSILLRAFEGVSALPASASALLAVR
EYLKANEVDGPVVAVITGRWRREKR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtggaggagggagactcatctagtagtaaacttttagcgctctcaacccccctgctcaag
ctcacatctctcaggaagcttctcaaccttgacggcgccgctgtctacttgaagtacgag
ggctacaaccccacgggtacgcacaaggacagggctgccctcgcgcacgtgggagaggcc
gttctcaacggctacgacacggtgacggtcgggacctgcggtaactacggcgtcgcggta
gcgtactacgctaggctcgcggggcttagggcggtgatattcgtcccgaagggctacagc
aacagtagggtgccggagatgaagaggtacggggcgcgtgtagtggaggtggaggggccc
tacgaggacgcggtcgcggtaagcgtgagctccgcaagggctaacgggtggtacgacgcg
aaccccggtagcgtgaacgaccacgttagcatagaggcttactccctcatagcgagggag
atcgtgaggcagctcggagacgcccctgccgtagtggctgtacccgtggggaacggaacc
acgctcgtagggatataccacggcttctacaggctgtacagagccggggagactacgagg
atcccgaggatggtcgctgccagcacgtccaacgcgaaccagctcgtctactcctggagc
agggggtcgacggagcccctaccggtcgaggtctccgaggtgcgcgaaaccccggtgaac
gagccgctcgtcgcgattaggtcgctgaacgccgaggaggctctgagagctatatacgcg
tctaagggcgcggcgttcggcttcagcgactccgagatggtcgagatgtcgatactcctc
agggcgttcgagggggtaagcgctctacccgcgtcggcgtccgcgctcctggctgtacgc
gagtaccttaaggcaaacgaggtcgacggcccggtagtagcggtgataacggggagatgg
aggagggagaagcggtaa

DBGET integrated database retrieval system