KEGG   Thermofilum pendens: Tpen_1649Help
Entry
Tpen_1649         CDS       T00446                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tpe  Thermofilum pendens
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tpen_1649
Enzymes [BR:tpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tpen_1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1597203..1598129
Genome map
AA seq 308 aa AA seqDB search
MAFYDVVTLGHILLDLRFCVDAFATPDREGVIKSQSHGVGGSAANVAIGVRRLGGRSAVI
GKVGFDDFGKNALEDLVREGVDISNVRIDALNGKTGFTIVIIDSQGQIVMYGDKGVAESL
QPEEVNLKILKETGHLHIASLRVDTSAFVAKAAKELGVRVSWDPGRRQARMGIEALKPIV
RLADIVLPNEIEVKAIAGVEDVKEAANVLLGEGAGLVIVKRGSRGVYVVSKDEEFEVPAY
RPETVVDTTGAGDAFAAGLLMGLKRFDLRDAVRFATVVAGLKVTRLGSHEIPTWSEAMEV
FEKVKQKQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctacgacgttgtaacgctcgggcacatactcctggacttgaggttctgcgta
gacgccttcgcaacgcccgacagggagggcgtcattaagagccagagccacggcgtcggg
ggaagcgcggcgaacgtcgcgataggggttaggaggctcggggggcgctccgccgtcata
gggaaggtggggttcgacgacttcgggaagaacgccctcgaagacctcgtaagggagggg
gtcgacatctccaacgttaggatagacgcgctgaacggcaagacgggcttcacgatagtg
atcatcgactcccaggggcagatagtgatgtacggggacaagggggtcgccgagtccctt
caacccgaggaggtgaacctcaagatactcaaggagacggggcacctccacatagccagc
ctcagggttgacacctcggctttcgtggcgaaggcggcgaaggagctgggagtgagggtc
tcgtgggacccggggcgcaggcaggcgaggatggggatcgaggcgctcaaacccatagtc
aggcttgcggacatagtgctacccaacgagatagaggtgaaggcgatagccggcgtagaa
gacgtcaaggaggccgcgaacgtgctactaggcgagggggcgggcttagtgatagttaag
cggggtagcaggggcgtctacgtggtctccaaggacgaggagttcgaggtccccgcgtac
aggcccgagaccgtcgtcgacaccacgggggccggcgacgcgttcgcggcggggctactc
atgggcttgaagaggttcgacctccgggatgccgtgaggttcgcaaccgtggtggcaggg
ctgaaggtaacccggcttgggtcgcacgagataccgacttggagcgaagctatggaggta
ttcgagaaggtaaagcagaagcagtag

DBGET integrated database retrieval system