KEGG   Thermofilum pendens: Tpen_1675Help
Entry
Tpen_1675         CDS       T00446                                 

Definition
(GenBank) glycoside hydrolase, family 1
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
tpe  Thermofilum pendens
Pathway
tpe00052  Galactose metabolism
tpe00511  Other glycan degradation
tpe00600  Sphingolipid metabolism
tpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tpen_1675
  Lipid metabolism
   00600 Sphingolipid metabolism
    Tpen_1675
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Tpen_1675
Enzymes [BR:tpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Tpen_1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ABL79070
JGI: Tpen1675
UniProt: A1S0U0
Position
complement(1620717..1622258)
Genome map
AA seq 513 aa AA seqDB search
MSTMMFPQKFRWGVSESGFQFEMGDEYRRFIDTNTDWWHWVRDPHNISSRLVSGDLPEDG
INYFELFGKDHELARELGLNTYRLGIEWSRIFPHPTWFIEVDFEKDSLGFVKSVRIDEDT
LRALDRYACRKAVQMYREILLDLRKRGFKVIVNLVHFTLPYWIHDPIRAKSSELSEGPLG
LLEESFPIEMAKYAAYVAWKFGDLVDMWSTFNEPVVPIELGYLGTYTGFPPGVNKPQAVP
KALVNTAIAHALAYDMIKKFDNVKADPDSNSPAEVGLIYNIIPAYSPEGTKSEKAVEHYS
YFHNELLLEAVKNGRLDVALDGKNILKPAALGGKLDWLGVNYYTRIVVKESSRRFNGHPV
LDFEAVAGYGYACVPFGLSKIGRACDGMGWEFYPEGLIDALRIGSTYASKLLVTENGTSD
PRDVIRPSYLVNHLYALLLAIEEGINVEGYLHWALTDNYEWAHGFRQRFGLFEVDLITKS
RIPRHSSRIYKHIIQQGFIPSEYKKDIVEFRGI
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaatgatgtttccgcaaaaatttaggtggggagtctccgagtcaggttttcag
ttcgagatgggagacgagtataggcgcttcatagacacaaacaccgattggtggcactgg
gtacgtgaccctcacaacatctcttccagacttgtcagtggagatctgccagaagacggt
ataaactacttcgaactatttgggaaggatcatgaattggcaagggagctgggacttaac
acttacaggctgggaatagagtggagcagaatctttccacatccgacctggtttatagag
gtagattttgagaaggattccttgggtttcgttaagagcgtaaggatagacgaggatacc
cttagggctctggacaggtatgcttgtcggaaggccgtgcagatgtacagagaaatactg
cttgacttacgcaaaagaggattcaaagtaatcgtaaaccttgtacactttacgttacct
tactggattcacgaccctataagggcgaagtcttctgagctttctgagggacctttaggc
ctcctcgaggaaagcttccctattgagatggcgaagtacgcagcttacgttgcatggaag
tttggcgacttagtagatatgtggtccacgtttaatgaaccagtagtacctatagagcta
ggctatctaggcacttacacaggttttcctccaggtgtcaataagccccaggcagttcct
aaagcattggtaaacactgctatcgctcatgccttagcttacgatatgataaagaagttt
gacaatgtaaaggctgatcccgactctaattctccggcagaggtgggtctaatctacaat
ataattccagcatactctcccgagggaacaaaatcagaaaaagccgttgagcattattca
tatttccataacgagttgctactagaggccgtaaagaacggcagattagatgtcgcgctt
gacggcaaaaatatccttaaacccgctgctctaggcgggaagcttgactggttaggtgtt
aactactacactaggattgttgtcaaagagtcttctcgtcgctttaacggacatccagta
ttagacttcgaagcagtggctggttacggatacgcttgtgttccgttcggactctcgaag
attggaagagcttgtgatggaatggggtgggagttctatccagaagggcttattgatgca
ttgaggattgggtcgacctacgcgagtaagcttttagtcacggagaacggcacctccgat
cctagggacgtaatacgtcccagttatctcgtaaaccatctgtatgcattattactagcc
atagaggaaggaataaatgtagaaggttatttgcattgggcgttaacggataactacgag
tgggctcatggttttcggcaacgtttcggtttgttcgaagtagacctcatcacgaagagt
agaattccaaggcattcttcaaggatttataagcatataatccagcaaggttttatacca
agtgagtataagaaagacatcgtcgagtttagggggatatag

DBGET integrated database retrieval system