KEGG   Thermofilum pendens: Tpen_1765Help
Entry
Tpen_1765         CDS       T00446                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
tpe  Thermofilum pendens
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tpen_1765
   01230 Biosynthesis of amino acids
    Tpen_1765
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_1765
Enzymes [BR:tpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Tpen_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1705208..1706284
Genome map
AA seq 358 aa AA seqDB search
MLVPIRVLVNGIGTIGKRVAHAVSLQPDMVLVGVSSPRPSLGVLSSLSRGGVLEGVPFYV
RGASPSLFEERGVRVGGVLEDLLGSGRVDVVVDAAPGGEGLRNRDELYSRYGVRAVFQGG
EPAAVAELTFSPFFNYGDAFGRRYVRVPSCNTTGILRVVSALSSLGELREVFVVIARRAA
DPADRKGARLNALSLDGGVPSHHASDVRTVLPWLNVFTVAVKVPTTLAHLHVARVRLGGR
LSRGDVIEALESHRRIVVAGGEFEATPDLLEFFRDRRLRGDMYEVAVLEDSVHVDGEYAT
LSYVVHQEAVVIPENIDAVRAMFLGGDPEAGMEATDSSLGVTRGRLAPRRALVAARQS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgccgataagagtacttgtgaacggtatcggtactattggcaagagggtggcg
cacgccgtctcgctacagcccgacatggtgcttgtaggtgtatcgtcgccgaggcctagc
ctcggggttcttagtagcttgtctcggggaggggtcctcgagggtgtgcctttctacgtg
cgcggcgctagtccctcgctgttcgaggagcgcggagtgagggttggcggtgttctcgag
gacttgcttgggagtgggagggtggacgtcgtggtggacgcggcgcccgggggcgagggg
ctgaggaacagggacgagctttactcgaggtacggtgttcgcgcggtcttccagggtggt
gagccggcggctgtcgcggagctcacgtttagccccttcttcaactacggggatgctttc
ggcaggaggtacgtcagggttccgtcttgcaatactaccggtatcctgagggttgtcagc
gctctttcctcgctgggagagctgcgcgaggtcttcgtcgtcatagctaggagggctgcg
gacccagcggataggaagggagcgcgcctcaacgctttgagcctcgacggaggcgtcccg
tcgcaccacgcgtcggacgttaggactgttctcccctggctgaacgtgttcacggtggct
gtgaaagttccgaccaccctcgcgcacctccacgttgcgcgcgtaaggctcggcggcagg
ctgtcgaggggcgacgtcatcgaggctctggagtcgcacaggaggatagtcgtcgcagga
ggcgagttcgaggcgaccccggatctcctggagttcttccgggacaggaggcttaggggc
gacatgtacgaggtagccgtgctagaggactctgtgcacgtagacggcgagtatgcgacg
ctgtcgtacgtggttcaccaggaagccgtggtgatccccgagaacatcgacgctgtgagg
gcgatgtttctaggcggagacccggaggccggcatggaagccactgatagttctctcggc
gtaacgagggggcgcctcgctccgcgcagggcgcttgttgccgcacgacagtcttga

DBGET integrated database retrieval system