KEGG   Thermofilum pendens: Tpen_1765Help
Entry
Tpen_1765         CDS       T00446                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
tpe  Thermofilum pendens
Pathway
tpe00010  Glycolysis / Gluconeogenesis
tpe01100  Metabolic pathways
tpe01110  Biosynthesis of secondary metabolites
tpe01120  Microbial metabolism in diverse environments
tpe01130  Biosynthesis of antibiotics
tpe01200  Carbon metabolism
tpe01230  Biosynthesis of amino acids
Module
tpe_M00002  Glycolysis, core module involving three-carbon compounds
tpe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tpen_1765
Enzymes [BR:tpe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Tpen_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: ABL79160
JGI: Tpen1765
UniProt: A1S130
Position
1705208..1706284
Genome map
AA seq 358 aa AA seqDB search
MLVPIRVLVNGIGTIGKRVAHAVSLQPDMVLVGVSSPRPSLGVLSSLSRGGVLEGVPFYV
RGASPSLFEERGVRVGGVLEDLLGSGRVDVVVDAAPGGEGLRNRDELYSRYGVRAVFQGG
EPAAVAELTFSPFFNYGDAFGRRYVRVPSCNTTGILRVVSALSSLGELREVFVVIARRAA
DPADRKGARLNALSLDGGVPSHHASDVRTVLPWLNVFTVAVKVPTTLAHLHVARVRLGGR
LSRGDVIEALESHRRIVVAGGEFEATPDLLEFFRDRRLRGDMYEVAVLEDSVHVDGEYAT
LSYVVHQEAVVIPENIDAVRAMFLGGDPEAGMEATDSSLGVTRGRLAPRRALVAARQS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgccgataagagtacttgtgaacggtatcggtactattggcaagagggtggcg
cacgccgtctcgctacagcccgacatggtgcttgtaggtgtatcgtcgccgaggcctagc
ctcggggttcttagtagcttgtctcggggaggggtcctcgagggtgtgcctttctacgtg
cgcggcgctagtccctcgctgttcgaggagcgcggagtgagggttggcggtgttctcgag
gacttgcttgggagtgggagggtggacgtcgtggtggacgcggcgcccgggggcgagggg
ctgaggaacagggacgagctttactcgaggtacggtgttcgcgcggtcttccagggtggt
gagccggcggctgtcgcggagctcacgtttagccccttcttcaactacggggatgctttc
ggcaggaggtacgtcagggttccgtcttgcaatactaccggtatcctgagggttgtcagc
gctctttcctcgctgggagagctgcgcgaggtcttcgtcgtcatagctaggagggctgcg
gacccagcggataggaagggagcgcgcctcaacgctttgagcctcgacggaggcgtcccg
tcgcaccacgcgtcggacgttaggactgttctcccctggctgaacgtgttcacggtggct
gtgaaagttccgaccaccctcgcgcacctccacgttgcgcgcgtaaggctcggcggcagg
ctgtcgaggggcgacgtcatcgaggctctggagtcgcacaggaggatagtcgtcgcagga
ggcgagttcgaggcgaccccggatctcctggagttcttccgggacaggaggcttaggggc
gacatgtacgaggtagccgtgctagaggactctgtgcacgtagacggcgagtatgcgacg
ctgtcgtacgtggttcaccaggaagccgtggtgatccccgagaacatcgacgctgtgagg
gcgatgtttctaggcggagacccggaggccggcatggaagccactgatagttctctcggc
gtaacgagggggcgcctcgctccgcgcagggcgcttgttgccgcacgacagtcttga

DBGET integrated database retrieval system