KEGG   Thermofilum pendens: Tpen_1829Help
Entry
Tpen_1829         CDS       T00446                                 

Definition
(RefSeq) nucleotidyl transferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tpe  Thermofilum pendens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tpen_1829
   00052 Galactose metabolism
    Tpen_1829
   00500 Starch and sucrose metabolism
    Tpen_1829
   00520 Amino sugar and nucleotide sugar metabolism
    Tpen_1829
Enzymes [BR:tpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tpen_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1772232..1773131)
Genome map
AA seq 299 aa AA seqDB search
MPSLSKGVLLAAGLGTRLVPYSKEMPKEMLPVFFGVNNSVYLKPVIQAVFEQFYEAGIRE
FCFVVGRGKRVIEDHFTPDWDFVEYLEKTGKNDYAELLRDFYEKVEKSYITWVNQPVPRG
TGHAVYMAKGFVGDDYFMAAATDNLFLGENIPRRLLEYFDRLRSPMLAVKRVRDPRRYGV
VIGSRVDTSIYRVEGIVEKPREPLSYLANTSLYIFPPEIFRAIEQTTPSPRGELEVTDSI
QILIRSGYQFYAYEAEADWIDIGTWETFLRAALVSLKHALGADKLSEILSELGIGAGKP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgctgtccaaaggagtacttctagcggcgggtctgggtacgcgactggttccg
tatagcaaggagatgcccaaagagatgctccctgtattcttcggcgttaacaactcggtg
tacctcaagcccgttattcaggccgtcttcgagcagttctacgaagccgggataagggag
ttttgcttcgtcgttggacgcgggaagagggtgatcgaggatcacttcacgccggactgg
gacttcgtagagtacctggagaaaactggcaagaacgactacgcggagttgctgagggac
ttctacgagaaggtggagaagtcctacatcacgtgggtgaatcagccggtgccccgcggg
actgggcacgcggtgtacatggctaaaggcttcgtcggggatgactacttcatggcggcg
gctaccgacaaccttttccttggagagaacataccgaggaggttgctggaatacttcgat
aggctgaggtcccccatgctcgcagtgaagagggttagggatccgcggaggtacggggta
gtcatcggaagcagggtggacacgtctatctacagggttgaaggcatagtcgagaagccg
cgcgaacccctctcgtacctcgcgaacacgtcgctctacatcttccccccggagatattc
agggccatagagcagacgacgccaagccctagaggagagctcgaggtgacggactccatc
cagatactcatcaggagtggctaccagttctacgcgtacgaggctgaagcggactggatc
gacattggaacctgggaaaccttcctgagagccgccctagtttcacttaaacacgcgttg
ggcgcggacaagctgtcggagattctaagcgagctggggatcggcgccggcaagccctga

DBGET integrated database retrieval system