KEGG   Thermofilum pendens: Tpen_1829Help
Entry
Tpen_1829         CDS       T00446                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tpe  Thermofilum pendens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tpen_1829
   00052 Galactose metabolism
    Tpen_1829
   00500 Starch and sucrose metabolism
    Tpen_1829
   00520 Amino sugar and nucleotide sugar metabolism
    Tpen_1829
Enzymes [BR:tpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tpen_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1772232..1773131)
Genome map
AA seq 299 aa AA seqDB search
MPSLSKGVLLAAGLGTRLVPYSKEMPKEMLPVFFGVNNSVYLKPVIQAVFEQFYEAGIRE
FCFVVGRGKRVIEDHFTPDWDFVEYLEKTGKNDYAELLRDFYEKVEKSYITWVNQPVPRG
TGHAVYMAKGFVGDDYFMAAATDNLFLGENIPRRLLEYFDRLRSPMLAVKRVRDPRRYGV
VIGSRVDTSIYRVEGIVEKPREPLSYLANTSLYIFPPEIFRAIEQTTPSPRGELEVTDSI
QILIRSGYQFYAYEAEADWIDIGTWETFLRAALVSLKHALGADKLSEILSELGIGAGKP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgctgtccaaaggagtacttctagcggcgggtctgggtacgcgactggttccg
tatagcaaggagatgcccaaagagatgctccctgtattcttcggcgttaacaactcggtg
tacctcaagcccgttattcaggccgtcttcgagcagttctacgaagccgggataagggag
ttttgcttcgtcgttggacgcgggaagagggtgatcgaggatcacttcacgccggactgg
gacttcgtagagtacctggagaaaactggcaagaacgactacgcggagttgctgagggac
ttctacgagaaggtggagaagtcctacatcacgtgggtgaatcagccggtgccccgcggg
actgggcacgcggtgtacatggctaaaggcttcgtcggggatgactacttcatggcggcg
gctaccgacaaccttttccttggagagaacataccgaggaggttgctggaatacttcgat
aggctgaggtcccccatgctcgcagtgaagagggttagggatccgcggaggtacggggta
gtcatcggaagcagggtggacacgtctatctacagggttgaaggcatagtcgagaagccg
cgcgaacccctctcgtacctcgcgaacacgtcgctctacatcttccccccggagatattc
agggccatagagcagacgacgccaagccctagaggagagctcgaggtgacggactccatc
cagatactcatcaggagtggctaccagttctacgcgtacgaggctgaagcggactggatc
gacattggaacctgggaaaccttcctgagagccgccctagtttcacttaaacacgcgttg
ggcgcggacaagctgtcggagattctaagcgagctggggatcggcgccggcaagccctga

DBGET integrated database retrieval system