KEGG   Treponema pedis: TPE_0784Help
Entry
TPE_0784          CDS       T02803                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tped  Treponema pedis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(856979..857782)
Genome map
AA seq 267 aa AA seqDB search
MYNIGTVIREIGMFFDNYPIKLSDTTKPFLLKGLKTAPAILLIHGYTGSPREMVWLGRQL
NEAGYNVYIPRLPGHGTNKDDFLASTWKDWLRAVCEDYINLCSDYGNVYVGGLSMGGLLT
ALIAARFNPEKIFLCAPAFIAYDNRIKFTPFLKFFIKTVPCGKKNCENDPEYASAIADYN
GIEYLAKSADLYRLQKLSLKNLPFIRSQTLTVLSKADKSVPFKVKNIIDKNLRTQNEYLI
LEKSGHIVVNGIEKEAVAKKIIEFLKD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgtataatatcggaacagttataagggagataggaatgttttttgataattacccgatt
aaactttcagatactacaaaaccgtttcttttaaagggcttgaaaaccgctccggcaatt
ttactcattcacggatacacgggttctccacgcgaaatggtttggcttggacgccaatta
aacgaagcaggatacaatgtctatattcctcgtcttccgggacacggaacaaataaagat
gattttttagcttcaacatggaaagactggcttagagcggtttgtgaagattatatcaat
ctttgttcggactacggcaatgtatatgtgggcggattatctatgggcggacttttaaca
gccttaattgccgcacgatttaatcctgaaaaaatatttttatgcgctcctgcatttata
gcttacgataaccgtataaaatttacaccttttttaaaattttttatcaaaacggttcca
tgcggtaaaaaaaactgtgaaaacgaccccgaatacgcttcagctatagcggactataac
ggtatagaatatttagcaaaatcggcggatttataccggctgcaaaaactttctttaaaa
aatctgccatttatccgctctcaaactcttacagtactttccaaagcggataaatccgtt
ccgtttaaagttaaaaatattatcgataaaaatttaaggacacaaaatgaatatttaatt
ttggaaaaaagcggtcatattgtagtaaacggcatcgaaaaagaagccgttgctaaaaaa
atcattgaatttcttaaagattaa

DBGET integrated database retrieval system