KEGG   Treponema pedis: TPE_2456Help
Entry
TPE_2456          CDS       T02803                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tped  Treponema pedis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tped00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TPE_2456 (malQ)
Enzymes [BR:tped01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TPE_2456 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2522072..2523694
Genome map
AA seq 540 aa AA seqDB search
MNRKSGILLHLTSLPNDEGIGTLGKEAFEFIDWLSRNKLGVWQMLPIGPTGYGDSPYASF
SAFAGNPYLISFNVLREQGFLSEEELNTYKNLTEKSCIPSAVNYGFISYHKTTMLKKAAE
TVSEKTKEDFNLKNKIEQFYNEEKFWLDDFAVFTAIKEFYDKKNNEENGSSGIWNTCWKK
NLALCNKEAVKNFSALHSKEIEIHKIIQFLFYAQWTELKHYAENKNIKLIGDIPIFAALD
SSDVWVNRNLFMLDENGRPTAVAGVPPDFFTAIGQLWGNPLYDWEAMKADGYLWWKKRIR
QMLKLFDIIRIDHFRGFEAFWSIPPDAPNAVSGKWVKGPDHHFFEEIQKDLYDLNSEYKN
GLPIIAEDLGVITDEVIRLRDDFNFPGMKILQFAFDLNEKQRGKLLNPYLPHNMPANCIA
YTGTHDNDTLIGWIENSSEEQLALVYSYITGIPVDGELYGKLKSDDIKKELCSAMVRLCF
SSPAELAIVQMQDILFAGKEARMNSPNTLGINWQWRMESSYCTNGITDKLIFWNMLYGRD
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaaatcgggaatacttttacatctaacatctcttcccaatgatgaagggata
ggaacgctcggaaaagaagcgtttgagtttatagattggctaagccgaaacaaactcggc
gtgtggcaaatgcttcctatagggcctacaggatacggagattctccttatgcctccttt
tccgcctttgcgggaaatccgtacttaataagttttaatgttttacgcgaacaaggcttt
ttgtccgaagaagaattaaacacatacaaaaatctgaccgaaaaatcctgcataccttcc
gcagtaaattacggctttataagctatcataaaacgactatgcttaaaaaagcggccgaa
accgtttcggaaaaaacaaaagaagattttaatttaaaaaacaaaatagaacaattttac
aacgaagaaaaattttggcttgatgattttgccgtatttaccgcaataaaagaattttac
gacaagaaaaataacgaagaaaacgggtcttcaggaatttggaatacctgctggaaaaaa
aatcttgcactttgcaataaagaagccgtaaaaaacttttccgctctgcattcaaaagaa
atagaaatacataaaataattcagtttttattttatgcgcaatggaccgaattaaaacat
tatgcggaaaataaaaatataaaactcataggtgatattccgatttttgcagctctggac
tcctcagacgtttgggtaaacagaaatctttttatgctggacgaaaacggccgaccgacg
gctgttgcgggggtaccgcccgacttttttactgcaataggacagctttggggaaatccg
ctttacgattgggaagctatgaaggcggacggctatctttggtggaaaaaacgcatacgt
caaatgcttaaactttttgacataatccgcattgaccatttccgcgggtttgaagccttt
tggtcaattccgcctgatgcgcctaatgcggtttccggaaaatgggttaaggggcctgac
catcatttttttgaagaaatacaaaaagatttatatgatttaaattcggaatacaaaaac
ggacttccgataatagccgaagatttaggagtaattaccgatgaggtaatacggctaaga
gacgattttaatttccccggaatgaagattttacaattcgcctttgatttaaatgaaaaa
caaagaggaaaacttttaaacccgtatttaccgcataatatgccggcaaattgtatcgct
tacacaggcactcacgacaacgacactctcataggctggattgaaaattcttccgaagaa
cagcttgccctcgtttattcttatattacgggaattcccgttgacggtgaattatacgga
aaattaaaaagcgatgatattaaaaaagagctgtgcagcgctatggtaagactttgtttt
tcctcccccgccgaacttgcaattgtacaaatgcaggatattctgtttgcaggaaaagaa
gcgagaatgaattctcccaatacattgggaataaattggcaatggcgtatggaaagctct
tactgcacaaacggaatcacggataaactgatattttggaatatgctgtacggaagagat
taa

DBGET integrated database retrieval system