KEGG   Treponema pedis: TPE_2456Help
Entry
TPE_2456          CDS       T02803                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tped  Treponema pedis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tped00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2522072..2523694
Genome map
AA seq 540 aa AA seqDB search
MNRKSGILLHLTSLPNDEGIGTLGKEAFEFIDWLSRNKLGVWQMLPIGPTGYGDSPYASF
SAFAGNPYLISFNVLREQGFLSEEELNTYKNLTEKSCIPSAVNYGFISYHKTTMLKKAAE
TVSEKTKEDFNLKNKIEQFYNEEKFWLDDFAVFTAIKEFYDKKNNEENGSSGIWNTCWKK
NLALCNKEAVKNFSALHSKEIEIHKIIQFLFYAQWTELKHYAENKNIKLIGDIPIFAALD
SSDVWVNRNLFMLDENGRPTAVAGVPPDFFTAIGQLWGNPLYDWEAMKADGYLWWKKRIR
QMLKLFDIIRIDHFRGFEAFWSIPPDAPNAVSGKWVKGPDHHFFEEIQKDLYDLNSEYKN
GLPIIAEDLGVITDEVIRLRDDFNFPGMKILQFAFDLNEKQRGKLLNPYLPHNMPANCIA
YTGTHDNDTLIGWIENSSEEQLALVYSYITGIPVDGELYGKLKSDDIKKELCSAMVRLCF
SSPAELAIVQMQDILFAGKEARMNSPNTLGINWQWRMESSYCTNGITDKLIFWNMLYGRD
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaaatcgggaatacttttacatctaacatctcttcccaatgatgaagggata
ggaacgctcggaaaagaagcgtttgagtttatagattggctaagccgaaacaaactcggc
gtgtggcaaatgcttcctatagggcctacaggatacggagattctccttatgcctccttt
tccgcctttgcgggaaatccgtacttaataagttttaatgttttacgcgaacaaggcttt
ttgtccgaagaagaattaaacacatacaaaaatctgaccgaaaaatcctgcataccttcc
gcagtaaattacggctttataagctatcataaaacgactatgcttaaaaaagcggccgaa
accgtttcggaaaaaacaaaagaagattttaatttaaaaaacaaaatagaacaattttac
aacgaagaaaaattttggcttgatgattttgccgtatttaccgcaataaaagaattttac
gacaagaaaaataacgaagaaaacgggtcttcaggaatttggaatacctgctggaaaaaa
aatcttgcactttgcaataaagaagccgtaaaaaacttttccgctctgcattcaaaagaa
atagaaatacataaaataattcagtttttattttatgcgcaatggaccgaattaaaacat
tatgcggaaaataaaaatataaaactcataggtgatattccgatttttgcagctctggac
tcctcagacgtttgggtaaacagaaatctttttatgctggacgaaaacggccgaccgacg
gctgttgcgggggtaccgcccgacttttttactgcaataggacagctttggggaaatccg
ctttacgattgggaagctatgaaggcggacggctatctttggtggaaaaaacgcatacgt
caaatgcttaaactttttgacataatccgcattgaccatttccgcgggtttgaagccttt
tggtcaattccgcctgatgcgcctaatgcggtttccggaaaatgggttaaggggcctgac
catcatttttttgaagaaatacaaaaagatttatatgatttaaattcggaatacaaaaac
ggacttccgataatagccgaagatttaggagtaattaccgatgaggtaatacggctaaga
gacgattttaatttccccggaatgaagattttacaattcgcctttgatttaaatgaaaaa
caaagaggaaaacttttaaacccgtatttaccgcataatatgccggcaaattgtatcgct
tacacaggcactcacgacaacgacactctcataggctggattgaaaattcttccgaagaa
cagcttgccctcgtttattcttatattacgggaattcccgttgacggtgaattatacgga
aaattaaaaagcgatgatattaaaaaagagctgtgcagcgctatggtaagactttgtttt
tcctcccccgccgaacttgcaattgtacaaatgcaggatattctgtttgcaggaaaagaa
gcgagaatgaattctcccaatacattgggaataaattggcaatggcgtatggaaagctct
tactgcacaaacggaatcacggataaactgatattttggaatatgctgtacggaagagat
taa

DBGET integrated database retrieval system