KEGG   Tetrapisispora phaffii: TPHA_0A00300Help
Entry
TPHA_0A00300      CDS       T02235                                 

Gene name
TPHA0A00300
Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tpf  Tetrapisispora phaffii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(40868..42169)
Genome map
AA seq 433 aa AA seqDB search
MVYEAKPFDPIVVNPNNKKRVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK
MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYC
SISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRV
LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDVGIGKGKNYAVNVPLRD
GMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNFVKS
FNIPMMVVGGGGYTMRNVARTWCFETGLLNNVILDEDLPYNDYYEYYGPDYKLDVRPSNM
FNVNSPEYLDKILTSIYSNLENTKYAPSVQLNHVPRDTEDLGDVEEDSREAMDTKGGSQY
ARDHIVEGDNEFY
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtgtatgaggcaaaaccttttgatccaattgtggttaacccaaataataaaaaaaga
gtagcgtacttctacgacgcagacgttggtaactatgcatatggtgctggccatccaatg
aaaccacatagaataagaatgacccactcgttagtgatgaattacggtttatataagaag
atggagatatatagagcaaaaccagctactaaacaagaaatgtgccaattccacacagat
gaatacattgactttttgtcgagagtcacacccgacaatctggatatgtttaaaaaagag
agtgtcaaattcaatgtcggtgacgattgtccagtatttgatggtctttttgaatattgt
agcatatcgggtggtggttctatggaaggtgctgctagattgaatagaggtaaatgtgat
gttgctattaattatgctggtggcttacatcatgctaagaaatctgaagcttccggattt
tgttatctgaatgatatcgtgttaggtattatcgaattactaagataccacccaagagtt
ctatatattgatatcgatgtccatcatggtgatggtgtcgaagaagcattttacacaacg
gatagagtcatgacctgttcctttcacaaatatggtgagtttttcccaggtacaggtgaa
ttaagagatgttggtattggaaagggtaagaattacgctgtaaacgttcccttaagagat
ggtatggatgatgctacatatagatcagtattcgaatccgtgatcagtaaaatcatggaa
tggtaccaaccttcagctgtggtactacaatgtggtggtgactctttatccggtgatcgt
ctaggttgtttcaatttatctatgagaggtcacgctaactgtgtaaattttgttaaatcc
tttaatatacctatgatggttgtaggtggtggtggttacactatgagaaacgttgccaga
acatggtgtttcgaaactggtttgttaaataatgtaatattagatgaagatctaccttac
aatgactactacgaatattatgggcctgactataaattagatgttagaccatctaatatg
tttaatgtcaactctcctgaatacttggataaaatcttaacttctatatattccaattta
gaaaacacaaaatatgcaccaagtgtgcagctaaatcatgttcctagagatacagaagac
ctcggtgatgtagaagaggattcaagagaggcaatggatactaaaggtggatcacaatac
gctagagatcacattgtagaaggtgataacgaattctattaa

DBGET integrated database retrieval system