KEGG   Tetrapisispora phaffii: TPHA_0A00360Help
Entry
TPHA_0A00360      CDS       T02235                                 

Gene name
TPHA0A00360
Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
tpf  Tetrapisispora phaffii
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:tpf03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(53520..54152)
Genome map
AA seq 210 aa AA seqDB search
MSVEEVTQKFESVSVDNNAPKTVLNDDKSFEVKHPLNTKWTLWYTKPAVDKSESWSDLLR
PVTSFNTVEEFWAIVKNIPEPHDLPLKSDYHVFRNDIRPEWEDSANEKGGKWSYHIRSKS
SDIDELWLRTLLAVIGETIDEEDSQINGVVLSIRKGTSKFALWTKSEDQTEALTNIGARF
KQVLKLGEEDKIEFIPHSSTGKNAQPTLTL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgaagaagttactcaaaaatttgaatctgtttctgtcgataacaatgctcca
aagactgttttaaacgatgataaatcttttgaagtcaagcatccattgaataccaaatgg
actttatggtacactaagccagctgttgacaagagtgaatcctggtctgatttattgaga
ccagttacttctttcaacactgttgaagaattttgggctattgttaagaacattccggaa
cctcatgatttaccattgaagtctgattatcatgttttcagaaatgatattagaccagaa
tgggaagattctgcaaatgagaagggtggtaaatggtcataccatattagaagcaaaagt
tctgacattgatgaattatggctaagaactttattagctgtcattggtgaaactattgac
gaagaagactctcaaataaacggtgttgttttatccattagaaaaggtacttctaagttc
gctttatggactaagtctgaagaccaaactgaagctttaacaaacattggtgcaagattc
aagcaagtattaaagttaggtgaagaagataagattgaattcattccacatagtagtact
ggtaaaaatgctcaaccaactttaactttgtaa

DBGET integrated database retrieval system