KEGG   Tetrapisispora phaffii: TPHA_0A01010Help
Entry
TPHA_0A01010      CDS       T02235                                 

Gene name
TPHA0A01010
Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tpf  Tetrapisispora phaffii
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TPHA_0A01010 (TPHA0A01010)
  Replication and repair
   03420 Nucleotide excision repair
    TPHA_0A01010 (TPHA0A01010)
Transcription machinery [BR:tpf03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TPHA_0A01010 (TPHA0A01010)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(196292..197806)
Genome map
AA seq 504 aa AA seqDB search
MSAITSKKSVNDYLEELPQQVQSKLYESPAACLSIYRLLPHMAKFFIMSMVFNDNEISIR
DLDRWVNSNGKLQFQDAIKSMKSLHILIPGKEQGSMFVNLNSTFRTSFRNALTGGEVNNS
FGNIIDKIDDLVDSSVLLEYAKDKWETILHFMVGTPLIKMPSDNVLNLLKHSKLMEELES
SGEFKITNDGFQFLLQDVNSQIWTLLLQYLKIAEALHMNPVDILNFIFMLGSLEFGKAYS
VEGLSDTQKKMLKDMRDYGLIFQKTSNATVFYPTTLATQLTSDSSTVRSASGAIDSLLSQ
TKEANNNDSQNLGTDTDDLVGNQSVEVGALVVETNFKLYSYSNSPLQIAILSLFVHLRTR
FSNMVTGQITRESIRNALANGVTADQIIAYLQSHAHPQMRRLAETTLKKKLELDPNTKDQ
LQILPPTVVDQIKLWQLELDRILSYDGSLYSDFDNNQEYNMLYNYAKDIGVLLWKNDRKR
KFFVSKEGNSQVLDFAKRKLKKKQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctatcacttcaaaaaaatcggttaacgattatttagaagaacttcctcaacag
gtacaaagtaaattatacgaatccccagcggcatgtctgtctatttatagactgttaccg
catatggccaagtttttcattatgtcgatggtattcaatgacaatgaaatatcgattcgt
gatttggacaggtgggtgaactctaatggtaaattgcaattccaggatgctattaagtct
atgaagtcattacatatcttgattcccggtaaagagcaaggttcgatgtttgtcaatttg
aattcgacttttaggacaagttttagaaatgcattgactggaggtgaagtgaacaattcg
ttcggtaatattattgacaagatagacgatctggtagattctagtgtgctgttggagtac
gctaaagataaatgggaaacaattttgcatttcatggtgggtacgccattgatcaagatg
ccatccgataatgtattaaatctattgaaacatagtaaactgatggaagaattagagagt
agcggtgaatttaagatcacgaatgatgggttccaatttcttctgcaagatgtcaactcg
caaatctggacgttgctattgcaatacctaaaaattgcagaggcgttgcatatgaacccc
gttgatattctaaatttcatattcatgctaggttctttagagtttgggaaagcgtacagt
gttgaaggattgagtgacacacagaagaagatgctgaaagacatgagagattacggttta
attttccaaaagacctccaatgctactgtattttatccaacaaccttagccacacaactg
acctcggactccagtactgtgcggagtgcctccggtgccatcgacagtctgttatcgcag
acgaaggaagccaacaacaacgactcgcaaaacctcggaaccgacaccgacgacctagtg
gggaaccaaagcgtcgaagtcggcgcactggtggtggagacaaacttcaaactgtactcg
tactcaaactcacctctgcagattgcgatcttgagcttgtttgtgcacttgcgcacgagg
ttttccaacatggtcaccggccaaattacccgtgagtccatcagaaacgcgcttgccaac
ggggtgacggcggaccagatcatcgcgtacttgcaatcgcacgcgcacccacagatgcgt
agattagcagagacgacgttgaagaagaagctggaactggacccaaacacaaaagaccaa
ctccaaatccttccccccaccgtagtggatcaaatcaagctatggcaactggaattggac
agaatactgagctacgacggctcgctgtactcggacttcgacaacaaccaagaatacaac
atgctatacaactatgccaaggacatcggcgtactgttatggaagaacgatagaaaacgt
aaattctttgtctcgaaagaaggtaattcgcaagtgctggactttgcaaagagaaaacta
aagaagaaacagtga

DBGET integrated database retrieval system