KEGG   Tetrapisispora phaffii: TPHA_0A01120Help
Entry
TPHA_0A01120      CDS       T02235                                 

Gene name
TPHA0A01120
Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TPHA_0A01120 (TPHA0A01120)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:216522..218618
Genome map
AA seq 698 aa AA seqDB search
MSSNNSDPLYRFHQQFKQFVQNNPNVISAARAAATIPESAKAVVVLSPLSLHHTFQRDWV
TKSYKKTIVERPERLLASSMGIAAAITMYPALFTLKTSHNKRGSIFSSYVRRIHGDRWPN
DLIKYCQEADKKLQNGEIEVPDSWNSGDIYLSSETIKAIEGSIGALELGLDSIFHGPSAE
HISNRAFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKYGVSHAVILDFDLHHGDGT
QDICWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSMHDINSFPTESGYATKD
NIKNASTCVMDAHDLNIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQMQEM
NKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVLSVLE
GGYSDKAIASGVFSHLIGLQNQNWIKEWGSEQVIKEIVRGCKPSWTPYKTKKSRDVIRIW
AEEVIGLGRSMINEFEDVLLEGKQASPNELFGTGDTHAQRLTRSQANEINNVIKKVPSEK
QSYQRSGYAGHTEKSRIASAKASSHSGRTLNLKKEVPFVDQEIPSDDDDEDYQYDEELNK
TFNRTVEDITIDDISRHLETLEIIQSDDDNETDERGSNKNSSKSGKYKTPMNTTSRNMKT
NRNSNILNFDDSDISMISHIGSTTRSRNSHTTRSGGNW
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaataatagtgacccactatataggtttcatcaacagtttaaacagtttgtt
cagaataacccaaatgttatctcagcagctagggctgctgctaccatccctgaaagcgct
aaagctgtcgtcgtgctttccccattatcattgcatcacactttccaaagagactgggtg
actaagtcgtataagaagactattgtggaaagaccagagagattattagcttcttccatg
ggtattgccgctgctattactatgtatcctgcgttattcactttaaagacttcgcataat
aagagaggatcaatattcagctcatatgttagacggatccatggtgacagatggccaaac
gacttgattaagtactgtcaagaagctgataagaagttgcagaacggtgagattgaagtt
cctgattcatggaattccggcgatatatatctgagttcggaaacaattaaagctattgaa
ggatccattggcgctctagagttaggtttggattctatattccacggcccatctgcggaa
catatcagcaacagagcctttgtagctatacgaccacctggtcatcattgtcatgtttct
actccgtcggggttttgtttgttaaataatgcacagatagcaattgaatacgcctatgaa
aaatatggtgtatcacatgcagtcatcttagattttgatttacatcacggtgatggcact
caagatatatgttggaaaagagctggattcaagccagatgatggtaatgttcaagatgat
gaagataaaaatgaatatgatgactttggtaagaaaatggccgactttccaaaagttggc
tacttctcaatgcatgacataaattcattcccaaccgaaagtggatacgctaccaaagat
aacatcaaaaatgcttccacttgtgtaatggatgcacacgatctcaatatttggaatgtt
catttacaaacgtgggctacagaggaagattttaataaattataccaaactaaatataga
actcttttcgcaaaagctgatgaattttttaagaatgcaaaaaaccaaatgcaagaaatg
aacaaaccatttaaaggtttggtggtaattagtgcaggtttcgatgcttcagaatttgaa
caaacttcgatgcaaagacactcagttaatgttccaactagtttttacactacattcaca
aaggatgcattgaaattggcccaactacattgtaatggtaaggtattgtctgttttagag
ggtggttattccgacaaagccattgcatctggtgtcttctctcatttgattggtttgcaa
aaccagaactggattaaggaatggggttcagaacaagttatcaaggaaattgtcagaggt
tgcaaaccttcatggactccatacaagactaaaaaatcccgtgatgtcattagaatatgg
gccgaagaagttattggtctaggtagatcgatgattaatgaatttgaggatgttttactt
gaaggcaaacaagcttcaccaaatgaattatttggcactggagatactcatgcccaaaga
ctcacaagatcacaagctaacgaaattaataatgtaataaagaaagttccgtcagaaaaa
caatcttaccaacgcagcgggtatgctggtcacactgagaaatccagaattgcatctgca
aaagcttcatcgcatagtggcagaactttgaacttaaagaaagaagttccttttgttgat
caagaaatcccaagcgatgacgatgatgaagattatcaatacgatgaagaattaaacaaa
acctttaatcgtaccgtcgaagatatcaccattgatgatatctcaagacatcttgaaaca
ttagaaataatacagtctgacgacgataatgaaactgatgaacgtggttctaataaaaat
agctcaaaaagtggtaaatataaaactccaatgaacaccacatcaagaaacatgaaaacg
aatagaaattcaaatatattaaatttcgacgatagtgatatctccatgatatctcacata
ggtagtacaactcgttccagaaattctcatactactagaagtggaggaaattggtag

DBGET integrated database retrieval system