KEGG   Tetrapisispora phaffii: TPHA_0A01530Help
Entry
TPHA_0A01530      CDS       T02235                                 

Gene name
TPHA0A01530
Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tpf  Tetrapisispora phaffii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TPHA_0A01530 (TPHA0A01530)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TPHA_0A01530 (TPHA0A01530)
  Amino acid metabolism
   00310 Lysine degradation
    TPHA_0A01530 (TPHA0A01530)
Enzymes [BR:tpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TPHA_0A01530 (TPHA0A01530)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:304416..305783
Genome map
AA seq 455 aa AA seqDB search
MLSRSVSKTLLSTTVRQSLKNKTNIHSSLKISSNVLGRRYISNVNVENNINGNYIRKQQT
NYVNGNKLWLINNRRFASTVVKVPQMAESLTEGTLKEFTKNVGDFVHQDELIATIETDKI
DVEVNAPFSGTIKKFLANPEDTVTVGGDLIEIEEGPAPEGNDAVKKESKPVKEKATEPVP
EKKPAETVQKSESKPVSTPAQEKPKKQEAVQNVFEPKTFTSFSRNERKVKMNRMRMRIAE
RLKESQNTAASLTTFNEVDMSGILEMRKLYKDEIIKTKNVKFGFMGLFSKACTLAAKDIP
SVNGAIEGDQIVYRDYSDISIAVATPKGLVTPVIRNAESLSVLEIEEEIVRLSKKARDGK
LTLEDMSGGTFTISNGGVFGSLYGTPIINTPQTAVLGLHGVKQRPVTLADGTIASRPMMY
LALTYDHRMLDGREAVTFLRTVKEYIEDPRKMLLA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgttatctagatctgtatccaagacgttgttaagtacaactgttagacaaagtttaaaa
aataaaacaaatatacattcttctttaaaaatttcttcaaatgtgttaggaagaagatat
atctcaaatgttaacgtagaaaataatatcaatggtaattatattaggaaacaacaaact
aattatgttaatggtaataagttatggttaattaataatagaagatttgcctcgacggtt
gttaaggttccacaaatggctgaatcattgactgagggtactttaaaagaatttactaaa
aatgtaggtgattttgttcatcaagatgagctaatcgcgacaatcgaaactgataaaatt
gatgttgaagttaatgcaccattttctggtacaattaaaaaattcttggcaaatcctgaa
gataccgtcactgtaggaggtgatttaattgaaatcgaagaaggtcctgctccagaaggt
aacgatgctgtgaaaaaggaaagtaagcctgtcaaagaaaaagcaacagagcctgtccca
gaaaagaaaccagcagaaactgtgcaaaaatcggaatcaaaacctgtatcgacacctgct
caagaaaaaccgaagaaacaggaagcagtacaaaatgtttttgagccaaaaacattcaca
tcattttctcgtaatgaacgtaaagttaaaatgaatcgtatgagaatgagaattgctgaa
agattaaaggaatcccagaacacagcagcatccttaactacattcaacgaagttgacatg
tctggtattttggaaatgagaaaattatacaaagatgaaattattaagacaaagaatgtt
aaatttggtttcatgggtttattttctaaagcttgtactttagctgccaaggacattccg
tccgtaaatggtgctattgaaggtgaccagatagtttaccgtgattattctgatatatca
attgcagtagctacaccaaagggtttagttactcccgttatccgtaatgccgaatcgtta
tctgttttggaaatagaagaagagattgttcgtttaagtaaaaaagctagagacggtaaa
ctaaccttagaagatatgtctggtggtacatttactatctcaaatggtggtgtgtttgga
tcattgtatggtactccaatcataaacactccacaaactgctgttttaggtctgcacggt
gtcaaacaaagacctgtcactttagctgatggtaccatagcttcaagaccaatgatgtac
ttagctttaacttatgatcacagaatgttagacggtagagaggctgttacatttttgaga
acagttaaagagtatattgaagatccaagaaagatgttgttggcctag

DBGET integrated database retrieval system