KEGG   Tetrapisispora phaffii: TPHA_0A01630Help
Entry
TPHA_0A01630      CDS       T02235                                 

Gene name
TPHA0A01630
Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
tpf  Tetrapisispora phaffii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    TPHA_0A01630 (TPHA0A01630)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TPHA_0A01630 (TPHA0A01630)
Protein kinases [BR:tpf01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TPHA_0A01630 (TPHA0A01630)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(328040..329347)
Genome map
AA seq 435 aa AA seqDB search
MSTNEEFIRTQIFGTVFEITNRYVDLNPVGMGAFGLVCSATDTLTTQPVAIKKIMKPFST
AVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPNDV
IDTICSENTLKFVTSLPHRDPVPFSERFKTVEPDAVDLLEKMLVFDPKKRLTAANALAHS
YLAPYHDPTDEPVAEAKFDWNFNDADLPVDTWRVMMYSEILDFHKIDGTDGQIDTSATFD
DQVAAATAAAAQAQAQAQIQAQIQAQAHSQAQDISNAHATDQGKNIPNDQAVNAVNETIS
NYADQAIQYANEFQQ
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgaatgaagagtttattagaactcaaatattcggtacagtttttgaaattaca
aacagatatgtagatctaaaccctgttggtatgggtgcctttggattggtttgttcagct
acagatactttgactactcaaccagtagccattaaaaagattatgaaacctttctcaact
gctgttttggcaaaaagaacctacagagaattaaaattattgaaacatttaagacatgaa
aatttaatttgtttacaagatatctttctatctccattagaagacatttatttcgtaaca
gagttacaaggaacagatttacacagattattacaaacaagaccccttgagaaacaattc
gttcaatacttcttatatcaaatcttaagaggtttaaaatatgttcattcagcaggtgtt
attcatagagatttaaaaccaagtaatatattgattaatgaaaactgtgacttaaaaatt
tgtgattttggtttagcaagaattcaagatccacaaatgacaggttacgtttcaacaaga
tattacagagctccagaaattatgttaacgtggcaaaaatacgatgttgaagttgatatt
tggtctgcaggttgtattttcgccgaaatgatagaaggaaaaccattgttcccaggtaaa
gatcacgttcatcaattctcaatcatcactgacttattaggttcgccaccaaatgatgtt
attgatacaatttgttcggaaaataccttaaagtttgtcacttcattgcctcacagagac
cctgttccattctctgagagatttaaaaccgtagaaccagatgcagtagatctattagaa
aaaatgctagtattcgatccaaaaaagagattaactgctgccaatgctttagctcactca
tatctggctccttaccatgatccaacagatgaaccagttgccgaagcaaaatttgattgg
aatttcaatgatgcagatttgcctgtggatacatggagagtcatgatgtactcagaaatt
ttagacttccacaaaatagatggtacagatggtcaaatcgatacatctgctactttcgat
gaccaagtagcagcagccacagcagcagcagcccaggctcaggcccaagcacagatccaa
gcacaaattcaagctcaagctcattcacaagcgcaagatatatcaaatgcacatgctact
gatcagggcaaaaacattccaaatgatcaagctgtaaatgccgttaatgaaaccatctca
aattatgcagatcaagctattcaatacgccaatgaatttcaacaataa

DBGET integrated database retrieval system