KEGG   Tetrapisispora phaffii: TPHA_0A02510Help
Entry
TPHA_0A02510      CDS       T02235                                 

Gene name
TPHA0A02510
Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
tpf  Tetrapisispora phaffii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:join(536076..536097,536233..537728)
Genome map
AA seq 505 aa AA seqDB search
MSSNKLNFNIKHSGKLYPIFINNDTTLGELKTEVEKLTMVPHSRQKYMVKGSLTDDTINN
LSTIFKQGSTVMLLGTPDADLISKPKKQSSFIEDLAPDQQMQKLNDLPIGFQNMGNTCYM
NSTLQALFRVDVLKDMILNYKTEGNNISPEDELHHKIVIELKKCFETLDGKKFKAVMPVV
LLSVLRKCYPQFAERDSQSGFYKQQDAEELFTQLFQTLKIVFGDKFNNNFEIEFRTTIKD
TANENDVTVKENETDSKLQCHISGITNFMKNGLLESLHETIEKRSDITGVNSTYSVDKEI
TKLPKYLTVQYVRFFWKRSTNKKSKILRKVQFPFQLDVSDLLTPEYAQEKIKVREELRVV
EKDKLNDEREIKRCKLNGDSLFDDADTSTEATAMTPKEKQEMETALIKSRKEHWLEEYKK
RFPKDLQAGENPSCVYDLIGIITHQGANSESGHYQSFIRDENDEDKWYKFNDDKVSEYEK
DKIEQLAGGGESDSALILIYKGMGL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagttccaataaattaaatttcaacattaaacattctggtaaactatatcctatcttt
atcaacaatgacactactcttggtgaactaaagacagaagtggaaaaactgactatggtt
ccacactcccgtcagaagtacatggttaaaggtagcttaactgacgatactattaataat
ttatcgactatattcaaacaaggatctactgttatgctgttgggaactccagatgccgat
ctgatttctaaaccaaaaaaacaaagcagttttattgaagatttagctccagatcaacaa
atgcaaaaactaaatgatttgccaattggtttccaaaacatgggtaatacttgctacatg
aattccactttacaagcattgtttcgtgtagatgtgttaaaagatatgattttaaattac
aaaactgagggtaacaacatcagtcctgaagatgaattacatcataagattgttattgaa
ttaaagaagtgttttgaaactttagatggcaaaaaatttaaagcagtcatgcctgttgtg
ttattaagtgtcttgagaaaatgctatcctcaatttgctgagcgtgattcccaaagtgga
ttttataagcaacaagatgcagaagaattatttacacaattatttcaaactttaaaaatt
gtctttggtgacaaatttaataataactttgaaattgaattcaggacaacaatcaaagac
actgctaacgaaaatgacgttactgttaaggaaaatgaaacggattcaaaattgcaatgc
catattagcggtataaccaatttcatgaagaatggattattagaatcattacatgaaacg
attgaaaagagatctgatataactggtgtgaactctacttattctgttgataaagaaatt
accaaattgccaaaatatttaacagttcaatatgttagatttttctggaaaagatctacc
aacaaaaaatctaagattttacgtaaagttcaatttccatttcaactagatgtttctgat
ttattaacaccagaatatgctcaagaaaagatcaaagttcgcgaagaattaagagtagtt
gaaaaagacaaactgaatgatgaaagagaaattaaaagatgtaaattaaatggtgatagt
ttattcgatgatgccgatactagcacagaggcaactgccatgactccaaaagagaaacaa
gaaatggaaaccgcattaataaaaagccgtaaagaacattggttagaagaatataagaaa
cgtttccctaaagatttacaagcaggtgagaatccatcgtgtgtttacgatttaataggt
atcataacacatcaaggtgccaatagtgagagtggacattatcaatcatttatcagagat
gaaaatgatgaagataaatggtataagttcaatgatgataaagttagtgagtacgaaaaa
gataaaatcgagcaattggccggtggtggtgaaagtgacagtgctttaattctaatttat
aaaggtatgggtttgtga

DBGET integrated database retrieval system