KEGG   Tetrapisispora phaffii: TPHA_0A02550Help
Entry
TPHA_0A02550      CDS       T02235                                 

Gene name
TPHA0A02550
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tpf  Tetrapisispora phaffii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TPHA_0A02550 (TPHA0A02550)
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TPHA_0A02550 (TPHA0A02550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(547596..548609)
Genome map
AA seq 337 aa AA seqDB search
MGITVVGSLNYDLVTYTNRVPNAGETIRADIFETHTGGKGLNQAIAISKLRQEGSNYLVR
MVGNVGQDSFGTELIDILEKNDVDCSNVGRIADVKTGIATILVEKEKGQNRILITEGANG
KTIFTDSQMNQIFKVEQANDCEFVVFQHEIPDPCSIMKWLKKHRPNHQIIFNPSPFQPLQ
KEDWSLIDILIVNEIEAMQIVESIYSKEEAERFAEKIKKDFIDGYKVLCQKFQQSIVNTS
DNSLGAVIITLGSEGVLFLSKDHVTVGYYPACSNIEVIDTTGAGDTFLGAVVTQLYQSIS
LEQAMKFATTASSITIQHKGAAESIPLYNDVLKNIEY
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgggtattaccgtagtcggttcattgaactatgatttagtaacctacacaaacagagta
cctaatgcgggagaaactatcagagctgatatatttgaaactcatactggagggaaaggt
ttgaaccaagcaattgcaatttcgaaattaagacaagaaggttcaaattatttggtaaga
atggtaggtaatgtggggcaagacagctttggaactgagctaatagatatactagaaaaa
aatgatgttgattgtagcaatgttggaagaatagcagatgtcaaaacaggaattgctacc
attctagttgaaaaagaaaaaggccaaaatagaattctgataacagaaggtgcgaacggg
aaaaccattttcactgatagtcagatgaatcaaatctttaaggttgaacaagcaaacgac
tgtgaatttgtggtatttcaacatgaaatcccagatccatgttccataatgaaatggctc
aagaagcatcgcccaaaccatcaaataatattcaatccttctccatttcaaccattacaa
aaggaagattggtctctgattgatattcttatagttaatgaaattgaagctatgcaaatt
gtagaatcaatatattccaaagaagaagctgaacgttttgcagaaaaaatcaaaaaagat
tttattgatggttacaaggttttatgccaaaagtttcaacaatctattgtaaatactagt
gataattcattgggtgctgtcatcataactttgggatctgaaggtgtcttatttttatca
aaagatcatgtaactgttggctattatccagcttgtagtaatatagaagtcattgataca
acaggagctggtgatacctttttaggagcagtagttactcagttatatcaaagtatatct
cttgaacaagcaatgaaatttgcaacgactgctagttcaatcaccattcagcataaaggt
gctgcagagagtatcccattgtataatgacgttttaaaaaatatcgaatattag

DBGET integrated database retrieval system