KEGG   Tetrapisispora phaffii: TPHA_0A02720Help
Entry
TPHA_0A02720      CDS       T02235                                 

Gene name
TPHA0A02720
Definition
hypothetical protein
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
tpf  Tetrapisispora phaffii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tpf00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    TPHA_0A02720 (TPHA0A02720)
Enzymes [BR:tpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     TPHA_0A02720 (TPHA0A02720)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(583093..585216)
Genome map
AA seq 707 aa AA seqDB search
MSVTPSQEHSAAISSKGVSGLKDFSGQEDKTEEALRSFIVLDDCKYASKNIGNAKNNEFM
ECDCYEEFEDGRNKACSEYSDCINRLTLIECVNGLCNTCGDNCENQKFQKKEYADISIFK
TELKGYGVRANSDLEENQFIYEYKGEVIEENEFRERLIEYDQRGFKHFYFMMLQSGEFID
ATIKGALARFCNHSCNPNAYVNKWEVAGKLRMGIFAKRRISKGEEITFDYNVDRYGATAQ
KCYCGESNCIGYMGGKTQTDSASLLPKNYADALGVQIFDGEKWIKEMKAQGIKIEKQVAN
NINMDFVESLELSACFSMDEVAKVMSVLLQIDNEYIGKKLLGRLFDILDETLLTQVIKFH
GYSCFAKLLKVYIKDIELVAQILEFLLRLPKSTKNGITSSQIDKEISKIISAEPELSKIG
NELLEKWNSYETYNRISKKEFNDSNKGGMIDLRRIKLPHGWEIIHENGRPMYYNAQLKTK
LHNPPNSTSNIFKVHSNPNVNKLANRSYNNLHNSPSGSDNRLNKRVKRNWVPDEEYEVKK
KLRIEQEQKALDEAKLQEEILLKEKFEQETRMRDDLAKIIEEANNQKQLAAMKDMEVTMQ
GEEKKKKKISKNKQEVLEHKWNKYFATFVPNILKKYKDQHNLSHDHIKNCARDIVKTLTA
KELKKNADKTPPEKPSSEKLAKVKSFVKGYMEKFIIKYNEKKRSKTV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaactccatcacaagaacattccgcagctatttcgtccaaaggggtatcagga
ttgaaagatttttctggacaagaagataaaactgaagaggctttaagatcgtttattgtc
ttggatgattgtaaatatgcttcgaaaaatattggtaatgcaaaaaataatgaattcatg
gaatgtgactgttatgaagagttcgaagatggtcgtaataaggcttgttccgagtattcg
gactgtattaatagattgactttgatagagtgtgtcaatggcttatgtaatacctgtggt
gataattgtgaaaatcaaaaatttcagaagaaagaatatgctgatatctctatattcaaa
actgaacttaaaggttacggtgtacgagcaaattcagatttagaggaaaatcaatttata
tatgaatataaaggtgaagttatcgaagaaaatgaatttagagagagattgattgaatac
gatcagaggggtttcaagcatttttactttatgatgcttcaaagtggcgaattcattgat
gcaacgattaaaggtgctttggccagattttgcaaccattcatgtaaccctaacgcatat
gtaaataaatgggaagtcgcaggtaagttaagaatgggtatttttgcaaagaggaggatt
tcaaaaggtgaagaaataacatttgactacaatgtcgatagatatggtgccacagctcaa
aaatgttactgtggtgaatcaaactgtataggttacatgggtggtaaaacacaaactgat
tcagcatcattattgccaaagaattatgctgatgccttgggtgttcagatcttcgatgga
gaaaaatggataaaagaaatgaaagctcaaggtataaaaattgaaaaacaagttgcaaat
aatatcaatatggatttcgtagaatctttggagctttcggcttgtttctctatggatgaa
gtagctaaagtcatgtctgttcttctacaaattgataatgaatatattggtaagaagtta
cttggtagattatttgacatattagatgaaactctattgacacaagtgattaaatttcat
ggatatagttgttttgcaaagttattgaaggtttatataaaggatattgaattagtagct
caaatattggagtttctacttagacttccaaaatcaactaaaaatggtataacatcatct
cagattgataaagaaatatcgaaaataatatcagcggaaccagaactttcaaaaattggt
aatgaattattggaaaagtggaatagctatgagacctacaatagaatttcaaagaaagag
ttcaatgatagtaacaaaggtggtatgattgatctaaggaggattaaactgcctcatgga
tgggaaattatccatgagaatggccgtcctatgtactataatgcccaattgaaaacaaag
cttcacaatcctccaaattcgacctctaatatatttaaagttcattctaatccaaacgtc
aataaattggctaatagaagttacaataatttacataacagtccatctggcagtgataat
cgtctaaataaaagagttaaaagaaattgggttcccgatgaggaatatgaagtaaagaag
aaattgagaatcgagcaagagcagaaagcgttagatgaagctaaacttcaggaagaaata
ttattaaaagaaaaattcgagcaagaaaccagaatgagagatgaccttgcaaaaattatt
gaggaagctaataatcagaaacaattagctgcaatgaaggatatggaagtgacaatgcag
ggagaagaaaaaaagaaaaagaagatatcaaagaataaacaagaggtcctcgaacacaaa
tggaacaagtactttgcaactttcgttccaaatatattaaaaaaatataaagatcagcat
aacttgagccatgaccatataaaaaattgcgcaagagatattgtcaagaccttaactgca
aaagagttgaagaagaacgccgataaaactcctccagagaagcctagttctgagaagctt
gcaaaggttaaatcttttgttaaaggatatatggaaaagtttataataaaatataatgag
aaaaagagatcaaagactgtctga

DBGET integrated database retrieval system