KEGG   Tetrapisispora phaffii: TPHA_0A04570Help
Entry
TPHA_0A04570      CDS       T02235                                 

Gene name
TPHA0A04570
Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
tpf  Tetrapisispora phaffii
Brite
Enzymes [BR:tpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     TPHA_0A04570 (TPHA0A04570)
Protein kinases [BR:tpf01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   TPHA_0A04570 (TPHA0A04570)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1038551..1040674
Genome map
AA seq 707 aa AA seqDB search
MEVDNEEISNGGGFWNPKYLEQNDSNGSGGNNNNNNDNNNSQGIQWNQNFLDSQPNVAAS
QVNSNFNMKRRKSSIIITPPSRTANTNPFQNKNIISDGNYNNSYIRNYDTTRRGSIAGYN
YSHVSNNSVRFPQQQLAPQQQQQSYYNQPPLGGYSLQKNLHRSKVKGFIDPNDLQRRQSV
ATVNYDTKQHINNINPNTGKPSVQNLHGSFNFRRRQSAYPIFNDSFAYNNSSGGNKKFSI
QKNDPINLIPTMFNVQSKSDLKPTLNILKDDTRRASINSQKISPLHALTSGLVTTYSLCS
PDFQYNLSKNPKRVLTKPSEPAYNNGFDNVNSDLILYVNSILGGENNNEINNTKYLVLDV
LGQGTFGQVVKCQNITTKALVAIKVIKSKSEYVNQSISEVRYLELINKKIDPENKHHFLR
LFDTFIHKNHLCLVFELLSNNLYELLKQNQFHGLNIRLIKILTKQLLDSLTILKMNKLVH
CDLKPENISLISPDKPDIKIIDFGSSCEETRTLYTYIQSRFYRAPEIMLGLPYSSSIDMW
SLGCIVAELFLGIPIFPGASEFNQLTRIVNTLGYPPTWMLLKGKNTNKYLINRVSSSNVN
DGNPNNTVTQVNNFELKTVNEFNLEYNASEKPSKRYFKYDSLDDIIRHYRIPRTIQGRPD
LLEAELKERECLIHFLHGLLNQNPFERFTPQEALMHPFITGDAFNNK
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggaggtcgataatgaggaaataagtaatgggggtgggttttggaaccccaagtattta
gaacagaatgacagtaatggtagcggtggtaataataataataataatgacaataataat
tcacaaggtattcagtggaatcaaaattttttggattcacaaccaaatgttgctgcttca
caagtgaattctaatttcaacatgaagaggagaaaatcaagtattatcattacccctcct
tccagaactgctaataccaaccctttccagaataagaatatcattagtgatgggaattat
aataacagttatataaggaattacgacaccactaggagaggttctattgctggttataat
tatagtcacgtttctaacaattcagtaaggttcccacagcaacagttggcaccacaacag
cagcaacagtcgtattacaaccaaccgccactaggtggctattccttgcagaaaaatttg
catcgcagtaaagttaaaggttttattgatccaaatgacctgcaaagaagacagagtgtt
gcaacggtcaattatgacacgaaacagcatataaataacatcaatccaaacacaggtaag
ccgtcagtacagaatttacatgggtcttttaatttcaggaggaggcaaagtgcttatcca
attttcaatgactcatttgcttataataatagttcaggtgggaataaaaaattttccatc
cagaaaaatgatcccattaatttaattccaacaatgttcaatgtacaatctaaatcagat
ttaaaaccaactttaaatattttaaaagatgatacaagacgtgcttcgatcaattctcag
aaaatttctccattgcatgcattaacttccggtttagtaacaacgtattcattatgttct
cctgatttccaatacaatttatcaaagaatcccaagagagtactaacaaaaccatctgaa
ccagcctataataatggttttgataatgtcaatagtgatttgattttatacgttaacagt
attttgggaggtgaaaataataatgaaattaataataccaaatatttagtattggatgta
ttgggacaaggtacatttggtcaggttgtcaaatgtcaaaatatcactacaaaggcgctc
gttgccattaaagtaatcaaatcaaagtcagaatatgttaatcaaagtatttcagaagta
aggtatttggaattgattaataaaaaaatcgatccagaaaataaacatcactttttaagg
ttatttgatacatttattcataaaaatcatttatgtttagtatttgaattattaagtaac
aacctttatgaattattaaagcaaaatcaatttcatggtttgaatattagattaattaaa
attttaacaaaacaactactagattcactaacaattttgaaaatgaataaattagttcat
tgtgatttaaaaccagaaaatatttcgttaatttctccagataaaccagatataaaaatt
attgattttggttcttcttgtgaagaaacaagaacgctttatacttatatccaatcaaga
ttttatagagctccagaaattatgttaggtttaccctattcttcaagtattgatatgtgg
tccttaggttgtatagtagcagaattatttttaggtattcccattttcccaggtgcttct
gaatttaatcaattaacgagaattgttaatactttaggttacccaccaacatggatgtta
ttaaagggaaaaaatacgaataaatatttaattaatagagtttcaagttcaaatgttaat
gatggcaatccaaacaatacagtaacccaagttaataattttgaattaaaaacagttaac
gagtttaacttggaatataatgctagtgaaaaaccaagtaaaagatattttaagtatgat
tcattagatgacattattaggcattatagaattccaagaactattcaaggtcgacctgac
ttgttagaagcggaattaaaagaaagagaatgtttaattcatttcttacatggtttatta
aaccaaaatccattcgaaagatttactcctcaagaagctttaatgcatccattcattaca
ggtgacgcattcaacaataaataa

DBGET integrated database retrieval system